DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and AT1G73875

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_683491.2 Gene:AT1G73875 AraportID:AT1G73875 Length:454 Species:Arabidopsis thaliana

Alignment Length:415 Identity:111/416 (27%)
Similarity:175/416 (42%) Gaps:117/416 (28%)


  Fly    18 IRRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLGNQAEGRDPHKCSSFKVVSYNILAQDLLL 82
            :|.|.||.      :|:::.||..|| ...|.|....|..|    :......:||||:|..|...
plant    61 VRHSKSSL------RRRRRTKEKISS-SVEREWVFSANNFE----NLADKLVLVSYNLLGVDNAS 114

  Fly    83 EHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEM-QFDHLPVLVQRLRMGNGKKLAYVY 146
            .|:.||..:|.:.|.|.||:..:.:|:.:.:..||||||: :||.|.||::      .:....|:
plant   115 NHMDLYYNVPRKHLEWSRRKHLICKEISRYNASILCLQEVDRFDDLDVLLK------NRGFRGVH 173

  Fly   147 KKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFA----------RFRFKKQQ 201
            |.:||..:|||||.:..:.|||||||.:| :|:   ...|:|||...          :.:.:.:.
plant   174 KSRTGEASDGCAIFWKENLFELLDHQHIE-FDK---FGMRNNVAQLCVLEMNCEEDPKSKLRVRS 234

  Fly   202 EQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFSTD---TPIVLTGDFNSLPDSSPIEFLV 263
            ...:..||...|:|||.||.|::..||...||:....|.:   .|:.:.||.||.|.|:..:|:.
plant   235 SDPRRLVVGNIHVLFNPKRGDIKLGQVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIA 299

  Fly   264 GKNGDVD-------------------------------------------------STACPEPLH 279
              :.|:|                                                 :|...|..|
plant   300 --SADLDTQLHDRRQISGQTEVEPKERSFRNHYAFSASASISGSLLNEWSQEELQLATGGQETTH 362

  Fly   280 -----------------FEIIDS-GEGTASTYQNEWV-IVDYILRSLGSRSRHKLLPLSVY-SLP 324
                             :...|. ||..|:||.:.:: .||||..:      .:|:|:.|. :||
plant   363 VQHQLKLNSAYSGVPGTYRTRDQRGEPLATTYHSRFLGTVDYIWHT------KELVPVRVLETLP 421

  Fly   325 S--INRCIGAGQIPNYRLGSDHYAL 347
            :  :.|   .|.:|:...||||.|:
plant   422 ADVLRR---TGGLPSENWGSDHLAI 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 98/364 (27%)
AT1G73875NP_683491.2 EEP 104..447 CDD:294334 97/362 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D704519at2759
OrthoInspector 1 1.000 T124578
orthoMCL 1 0.900 OOG5_135948
Panther 1 1.100 O PTHR12121
Phylome 1 0.910 0.789 Consistency score
76.970

Return to query results.
Submit another query.