DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and AT1G31500

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001323328.1 Gene:AT1G31500 / 840040 AraportID:AT1G31500 Length:422 Species:Arabidopsis thaliana


Alignment Length:446 Identity:119/446 - (26%)
Similarity:175/446 - (39%) Gaps:131/446 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHNVS----LKATSRIIRRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLG--NQAEG--RDP 62
            ||::.    |..:||:.|: |.|:....:...:.|.::.||...     ..:|  |:::|  ..|
plant     7 LHHLPRPNLLLPSSRVCRK-VISRRMSTNPAIEPKVRKFESVEG-----VDIGSRNKSDGFFAIP 65

  Fly    63 ---------HKCSS-----------------FKVVSYNILAQ----DLLLEHLFLYVGIPHEFLS 97
                     :.|.|                 |::||||||||    ..||.|      .|...|.
plant    66 LYLSKLVALYNCISLSRIGTSNENFVFSGIRFRLVSYNILAQVYVKSALLPH------SPPACLK 124

  Fly    98 WQRRQQNLLRELLKLDPDILCLQEM-QFDHLPVLVQRLRMGNGKKLAY--VYKKKTGCR-TDGCA 158
            |:.|...:|..|..|..|..||||: ::|       .....|...|.|  :|.::||.| .||||
plant   125 WKARSHAILSVLKNLQADFFCLQEVDEYD-------SFYRNNMDSLGYSGIYIQRTGQRKRDGCA 182

  Fly   159 IVYDSSKFELLDHQAVELYD----------------------------------QAVALLNRDNV 189
            |.|..|..||:..:.:|..|                                  ..:..|.||.|
plant   183 IFYKPSCAELVTKERIEYNDLVDSIKADSVSCSEQKIETSNEGKDSRKDSRDLNDPLVRLKRDCV 247

  Fly   190 ALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFST-------DTP-IVL 246
            .:.|.||..|  ..|...:||.|||.::.:.:||:.||.:.:|..|..|.|       .|| ::|
plant   248 GIMAAFRINK--PFQHIVIVANTHLYWDPELADVKLAQAKYLLSRLAQFKTLISDEFECTPSLLL 310

  Fly   247 TGDFNSLPDSSPIEFLVGKNG----DVDSTACPEPLH--FEIIDSGE--------GTASTYQNEW 297
            .|||||:|......:||..|.    .::....|.||.  :| :..||        |..:|     
plant   311 AGDFNSIPGDMVYSYLVSGNAKPTETIEEEEAPVPLSSVYE-VTRGEPKFTNCTPGFTNT----- 369

  Fly   298 VIVDYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGAVFTV 353
              :|||..|    ....:.|:|:..||..:.....|.:||:...|||..:||.|.:
plant   370 --LDYIFIS----PSDFIKPVSILQLPEPDSPDVVGFLPNHHHPSDHLPIGAEFEI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 100/344 (29%)
AT1G31500NP_001323328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.