DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and AT5G54130

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001078754.1 Gene:AT5G54130 AraportID:AT5G54130 Length:436 Species:Arabidopsis thaliana

Alignment Length:315 Identity:76/316 (24%)
Similarity:129/316 (41%) Gaps:83/316 (26%)


  Fly    49 RWTSLGNQAEG---RDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLS---------WQRR 101
            |.:.:|:.|..   ||.|:.......::||||.        :|..:.|:..|         |..|
plant     4 RISKIGSYAISSSIRDQHQQPCISCTTFNILAP--------IYKRLSHKDQSLRESDNRAYWLGR 60

  Fly   102 QQNLLRELLKLDPDILCLQEMQF--DHLPVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSS 164
            ...::..||.....|:||||...  :.|..|.:: |:|:...|:|.. .:|..|.||........
plant    61 NHRIIDWLLYERSSIICLQEFWVGNEELVNLYEK-RLGDAGYLSYKL-GRTNNRGDGLLTAVHKD 123

  Fly   165 KFELLDHQAV---ELYDQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLF--NTKRSDVR 224
            .|.:::.:.:   :..|:...||:.:.|..::      |.:..:|.::..|||||  ::..|.||
plant   124 YFRVVNSRDLLFNDCGDRVAQLLHVELVPPYS------QYDAHQEVLIVNTHLLFPHDSTLSIVR 182

  Fly   225 CAQVERILEELQSFSTDT-----PIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIID 284
            ..||.:||:.::|:..:.     ||:|.||:|.           .|.|.|          ::.:.
plant   183 LQQVYKILQYVESYQKEVNLSPMPIILCGDWNG-----------SKRGHV----------YKFLR 226

  Fly   285 SGEGTASTYQ----------NEWV----------IVDYILRSLGSRSRHKLLPLS 319
            | :|..|:|.          ::||          .||:|.....:|.| |||..|
plant   227 S-QGFVSSYDTAHRYTDSDAHKWVSHRNHRGNICAVDFIWLLNPNRYR-KLLKTS 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 70/292 (24%)
AT5G54130NP_001078754.1 EEP 32..>247 CDD:294334 59/253 (23%)
EF-hand_7 299..365 CDD:290234
EFh 299..365 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.