DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and AT5G11350

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001331448.1 Gene:AT5G11350 AraportID:AT5G11350 Length:755 Species:Arabidopsis thaliana

Alignment Length:263 Identity:79/264 (30%)
Similarity:120/264 (45%) Gaps:45/264 (17%)


  Fly    34 KQKAKEMESSHDRNRRW------TSLGNQAEGRDPHKCSSFKVVSYNILAQDLLLEH-LFLYVGI 91
            :|:.:...|.:   |.|      .|.|::          .|.|:||||||..|..:| ..||..|
plant   157 RQRPRSKPSDY---REWEYAKTPPSPGSE----------KFVVLSYNILADYLANDHWRSLYFHI 208

  Fly    92 PHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKLAYVYKKKTGCRTDG 156
            |...|||..|:..|:.||.....||:||||:  |....|.:.::   .:..:.::|.:||...||
plant   209 PRNMLSWGWRKSKLVFELSLWSADIMCLQEV--DKFQDLEEEMK---HRGYSAIWKMRTGNAVDG 268

  Fly   157 CAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFR-----FKKQQEQ--------QKEFV 208
            |||.:.|::|:|:..::::.....:    |||||......     ..|:.|.        ....|
plant   269 CAIFWRSNRFKLVHEESIQFNQLGL----RDNVAQICVLETLLTSHTKENETPPPESSAGSHRVV 329

  Fly   209 VATTHLLFNTKRSDVRCAQVERILEELQSFS---TDTPIVLTGDFNSLPDSSPIEFLVGKNGDVD 270
            :...|:|||.||.|.:..||..:|::..:.|   .|.||||.||||..|.|....|:..:..|:.
plant   330 ICNIHVLFNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPIVLCGDFNCTPKSPLYNFISDRKLDLS 394

  Fly   271 STA 273
            ..|
plant   395 GLA 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 72/222 (32%)
AT5G11350NP_001331448.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D704519at2759
OrthoInspector 1 1.000 T124578
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12121
Phylome 1 0.910 0.733 Consistency score
44.020

Return to query results.
Submit another query.