DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and AT3G18500

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001189925.1 Gene:AT3G18500 AraportID:AT3G18500 Length:449 Species:Arabidopsis thaliana

Alignment Length:420 Identity:112/421 (27%)
Similarity:164/421 (39%) Gaps:116/421 (28%)


  Fly    23 SSQAKGASGKRKQKAKEMESSHDRNRRWTS----------LGNQAEGRD---------PHKCSSF 68
            ||...|.|...    .|..|:...:|||.:          :.:....||         ......|
plant    49 SSSTSGPSDSN----PESSSNRSYSRRWQNPLPRRQHPDQIPSSQIARDWIDSDTTPVSQALERF 109

  Fly    69 KVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQ--FDHLPVLV 131
            .|||||||.......|..||..:...:|.|..|::.:..||::|:|||:.:||:.  ||...:: 
plant   110 TVVSYNILGDGNSSYHRELYSNVSVPYLKWGYRKRLICEELIRLNPDIISMQEVDKYFDLFSMM- 173

  Fly   132 QRLRMGNGKKLAYV--YKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFAR 194
                    :|..|.  ||::||...||||:.:.:.:|.:|:.:.:|.....:    |||||..|.
plant   174 --------EKAGYAGSYKRRTGDNVDGCAMFWKADRFGVLERENIEFSQFGM----RDNVAQLAV 226

  Fly   195 FRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFST---DTPIVLTGDFNSLPDS 256
            ...:|..:.:| .::...|:|:|..:.||:..||..:..:....|.   |.||||.|||||.|.|
plant   227 LELRKSNKSRK-ILLGNIHVLYNPNQGDVKLGQVRSLCSKAHLLSKKWGDIPIVLCGDFNSTPKS 290

  Fly   257 SPIEFLVG----------------KN-----------------------------------GDVD 270
            ....||..                ||                                   |..:
plant   291 PLYNFLASSELNVMEHDKKELSGQKNCRPTKVLETGSKSSNTITFRSFCSSWTKEEIRVATGQEN 355

  Fly   271 STACPEPLHF-----------EIIDS-GEGTASTYQNEWV-IVDYILRSLGSRSRHKLLPLSVY- 321
            |.....||..           ...|| ||..|::|.:::: .|||:..|.|      |||..|. 
plant   356 SYWAAHPLKLNSSYASVKGSANTRDSVGEPLATSYHSKFLGTVDYLWYSDG------LLPARVLD 414

  Fly   322 SLPSINRCIGAGQIPNYRLGSDHYALGAVF 351
            :||....|...| :|...|||||.||.:.|
plant   415 TLPIDVLCKTKG-LPCQELGSDHLALVSEF 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 99/353 (28%)
AT3G18500NP_001189925.1 EEP 111..445 CDD:294334 100/355 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D704519at2759
OrthoInspector 1 1.000 T124578
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12121
Phylome 1 0.910 0.727 Consistency score
66.070

Return to query results.
Submit another query.