DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and pde12

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001038753.2 Gene:pde12 ZFINID:ZDB-GENE-060519-25 Length:591 Species:Danio rerio

Alignment Length:341 Identity:82/342 (24%)
Similarity:133/342 (39%) Gaps:90/342 (26%)


  Fly    67 SFKVVSYNILAQ-----DLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQ--- 123
            |.:||||||||.     ||....|:.|.. |:. |....||..:.:||...:.||:||||:.   
Zfish   270 SLRVVSYNILADVYAQTDLSKTVLYPYCA-PYA-LQMDYRQNLIKKELSGYNADIICLQEVDKCV 332

  Fly   124 -FDHL-PVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVA---- 182
             .|.| |.|       :...|..|::.|.. :.:|.|..:..||.:|     ||.||..::    
Zfish   333 FVDLLCPAL-------DAFGLDGVFRIKEK-QHEGLATYFRRSKLKL-----VEQYDVMLSEALT 384

  Fly   183 -------LLNRDNVALFARFRFKKQQ------------EQQKEFVVATTHLLFNTKRSDVRCAQV 228
                   |..:.:.:...:.:.:|:.            :..:...|..|||.:..:..:||..|:
Zfish   385 TDPIHRQLWEKVSCSPSLKEKIEKRSTTLQVTVLQSLCDPSRILCVGNTHLYWRPEGGNVRLVQI 449

  Fly   229 ERILEELQSFSTD----TPIVLTGDFNSLPDSSPIEFLV-----------GKNGDVD-------- 270
            ...||.::...|:    ..::.:|||||.|.|...:.|.           |..|..:        
Zfish   450 AVALEHMKQVVTEKHPGARLIFSGDFNSTPSSGLFQLLSQGCIPEDHEDWGSGGPEEQIRLGLTN 514

  Fly   271 ----STACPEPLHFEIIDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYSLPSINRCIG 331
                |:||..|.....:...:|          .:|||.....:....:::||.  ||..::.|:.
Zfish   515 PFQLSSACGVPDFTNFVGGFQG----------CLDYIFVEPRTLQVEQVIPLP--SLEEVSNCVA 567

  Fly   332 AGQIPNYRLGSDHYAL 347
               :|:....|||.||
Zfish   568 ---LPSISHPSDHIAL 580

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 81/339 (24%)
pde12NP_001038753.2 EEP 273..586 CDD:294334 81/339 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.