DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Angel1

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_011242471.1 Gene:Angel1 MGIID:1915987 Length:690 Species:Mus musculus

Alignment Length:244 Identity:91/245 (37%)
Similarity:126/245 (51%) Gaps:23/245 (9%)


  Fly    48 RRWTSLGNQAE------GRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLL 106
            |.|.....|.:      |..|.  ..|.::|||||||||:.:...||:....:.|:|..|..||:
Mouse   241 REWEDFSTQPDAQGLEAGDGPQ--FQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFANLM 303

  Fly   107 RELLKLDPDILCLQEMQFDHL-PVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLD 170
            :|....|||||||||:|.||. ..|...|||   ......||::|||:|||||:.|..::|.||.
Mouse   304 QEFQHWDPDILCLQEVQEDHYWEQLEPSLRM---MGFTCFYKRRTGCKTDGCAVCYKPTRFRLLC 365

  Fly   171 HQAVELYDQAVALLNRDNVALFARFR----FKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERI 231
            ...||.:...:.|||||||.|....:    ....|.......||.||:|:|.:|.||:.||:..:
Mouse   366 ASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHVLYNPRRGDVKLAQMAIL 430

  Fly   232 LEELQ-----SFSTDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACP 275
            |.|:.     |..:..||:|.||.||:|||....|:  ::|::.....|
Mouse   431 LAEVDKVARLSDGSHCPIILCGDLNSVPDSPLYNFI--RDGELQYNGMP 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 85/217 (39%)
Angel1XP_011242471.1 EEP 268..683 CDD:294334 85/216 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84175150
eggNOG 1 0.900 E1_COG5239
Hieranoid 1 1.000
Homologene 1 1.000 H32251
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 1 1.000 T615897
orthoMCL 1 0.900 OOG5_135948
Panther 1 1.100 LDO PTHR12121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3577
TreeFam 1 0.960
1211.740

Return to query results.
Submit another query.