DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and CNOT6

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001357401.1 Gene:CNOT6 HGNCID:14099 Length:557 Species:Homo sapiens

Alignment Length:424 Identity:104/425 (24%)
Similarity:167/425 (39%) Gaps:127/425 (30%)


  Fly    19 RRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLGNQAEGRDPHK---CSSFKVVSYNILAQDL 80
            ||.::......||    .||.:.:.....|.|..|      ::|.:   .:.|.|:.||:|....
Human   147 RRLLNYLLDNLSG----TAKRITTEQPPPRSWIML------QEPDRTRPTALFSVMCYNVLCDKY 201

  Fly    81 LLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFD--HLPVLVQRLRMG-NGKKL 142
            ....|:.|  .|...|:|..|::.:::|:|..:.||:.|||::.:  :...||:....| ||   
Human   202 ATRQLYGY--CPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNG--- 261

  Fly   143 AYVYKKKTGCRT---------DGCAIVYDSSKFELLDHQAVELYDQAV-------ALLNR----D 187
              .:..|:..||         |||||.:.:.||.|:....||....|:       |:|||    |
Human   262 --FFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEGSEAMLNRVMTKD 324

  Fly   188 NVALFARFRFKKQQEQ----------QKEFV-VATTHLLFNTKRSDVRCAQVERILEELQS---- 237
            |:.:......:|:..:          :|:.: ||..|:.::.:.|||:..|....|.|:::    
Human   325 NIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDK 389

  Fly   238 ------------FSTDTPIVLTGDFNSLPDSSPIEFLV--------------------------G 264
                        |.| .|:||..|.||||||..:|:|.                          |
Human   390 ASRNLKSSVLGEFGT-IPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHG 453

  Fly   265 KNGDVDSTACPEPLH-FEIIDSGEGTASTYQNEWV----IVDYILRS---------LGSRSRHKL 315
            |||..:...    .| |::..:.|.....|.|...    |:|||..|         ||....|.|
Human   454 KNGTTNGRI----THGFKLQSAYESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWL 514

  Fly   316 LPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGA 349
            :.      .:|:.|      |:..:.|||::|.|
Human   515 VE------NNISGC------PHPLIPSDHFSLFA 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 93/371 (25%)
CNOT6NP_001357401.1 LRR 1 52..73
LRR 2 75..96
LRR 3 98..120
LRR 4 121..143
Nuclease domain. {ECO:0000250} 153..557 102/419 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84185379
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.