DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and angel2

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001025131.1 Gene:angel2 ZFINID:ZDB-GENE-030131-6498 Length:569 Species:Danio rerio

Alignment Length:380 Identity:108/381 (28%)
Similarity:158/381 (41%) Gaps:77/381 (20%)


  Fly    13 ATSRIIRRSVSSQAKGASGKRKQK--------------AKEMESSHDRNRRWTSLGNQAEGRDPH 63
            |...|.:|  |.|.....|.|..|              |....:..:..|.|..|.        |
Zfish   126 AEGEISQR--SPQHSPPKGSRSPKGSPEWLRNVSSIEVANRTSAVPELKRHWEDLS--------H 180

  Fly    64 KCSS--------------FKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDP 114
            .|.:              |.|:|||||:||||.::.:||.......|.|:.|..|:::||.:...
Zfish   181 LCKAAPSVNRGKQKWPFDFSVMSYNILSQDLLCDNTYLYRHCNPPVLDWRNRFPNIIKELEQYSA 245

  Fly   115 DILCLQEMQFDHLPVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELY 177
            ||:||||:|.||..   |::: .:.:.|.|  .:|::||.:.||||:::...:|.|:....||.:
Zfish   246 DIMCLQEVQEDHYK---QQIK-PSLESLGYHCEFKRRTGLKPDGCAVIFKRERFSLVSCHPVEYF 306

  Fly   178 DQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSF---- 238
            .:.|.|::||||.|....|............||.||||:|.:|.|::.||:..:|.|:...    
Zfish   307 RRGVPLMDRDNVGLIVLLRPIDPHVSLSNICVANTHLLYNPRRGDIKLAQLAMLLAEISRVSQLP 371

  Fly   239 -STDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSGE------------GTA 290
             |:..|::|.|||||:|.|....|:..:..|.|.....:....|....|:            |.:
Zfish   372 DSSVCPVLLCGDFNSVPWSPLYRFIKDRRLDYDGMPIGKVSGQEETPRGQRILTVPIWPRSLGIS 436

  Fly   291 STYQNEWVIVDYILRSLGSRSR---------HKLLPLSVYS-------LPSINRC 329
            ...|.|....|..||.|....|         |.|...|.||       .|.|..|
Zfish   437 QQCQYENQTRDSELRDLEQTERESFTEASIEHCLRLTSAYSHHLKESGQPEITTC 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 93/296 (31%)
angel2NP_001025131.1 EEP 201..563 CDD:294334 93/296 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84058952
eggNOG 1 0.900 E1_COG5239
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 1 1.000 T596637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3577
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.