DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and angel2

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001025131.1 Gene:angel2 / 562704 ZFINID:ZDB-GENE-030131-6498 Length:569 Species:Danio rerio


Alignment Length:380 Identity:108/380 - (28%)
Similarity:158/380 - (41%) Gaps:77/380 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ATSRIIRRSVSSQAKGASGKRKQK--------------AKEMESSHDRNRRWTSLGNQAEGRDPH 63
            |...|.:|  |.|.....|.|..|              |....:..:..|.|..|.        |
Zfish   126 AEGEISQR--SPQHSPPKGSRSPKGSPEWLRNVSSIEVANRTSAVPELKRHWEDLS--------H 180

  Fly    64 KCSS--------------FKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDP 114
            .|.:              |.|:|||||:||||.::.:||.......|.|:.|..|:::||.:...
Zfish   181 LCKAAPSVNRGKQKWPFDFSVMSYNILSQDLLCDNTYLYRHCNPPVLDWRNRFPNIIKELEQYSA 245

  Fly   115 DILCLQEMQFDHLPVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELY 177
            ||:||||:|.||..   |::: .:.:.|.|  .:|::||.:.||||:::...:|.|:....||.:
Zfish   246 DIMCLQEVQEDHYK---QQIK-PSLESLGYHCEFKRRTGLKPDGCAVIFKRERFSLVSCHPVEYF 306

  Fly   178 DQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSF---- 238
            .:.|.|::||||.|....|............||.||||:|.:|.|::.||:..:|.|:...    
Zfish   307 RRGVPLMDRDNVGLIVLLRPIDPHVSLSNICVANTHLLYNPRRGDIKLAQLAMLLAEISRVSQLP 371

  Fly   239 -STDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSGE------------GTA 290
             |:..|::|.|||||:|.|....|:..:..|.|.....:....|....|:            |.:
Zfish   372 DSSVCPVLLCGDFNSVPWSPLYRFIKDRRLDYDGMPIGKVSGQEETPRGQRILTVPIWPRSLGIS 436

  Fly   291 STYQNEWVIVDYILRSLGSRSR---------HKLLPLSVYS-------LPSINRC 329
            ...|.|....|..||.|....|         |.|...|.||       .|.|..|
Zfish   437 QQCQYENQTRDSELRDLEQTERESFTEASIEHCLRLTSAYSHHLKESGQPEITTC 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 93/295 (32%)
angel2NP_001025131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..92
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..155 8/30 (27%)
EEP 201..563 CDD:294334 93/295 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576690
Domainoid 1 1.000 129 1.000 Domainoid score I5222
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395901at33208
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - otm25767
orthoMCL 1 0.900 - - OOG6_105310
Panther 1 1.100 - - O PTHR12121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3577
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.