DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and cnot6l

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001018474.1 Gene:cnot6l ZFINID:ZDB-GENE-050522-302 Length:559 Species:Danio rerio

Alignment Length:374 Identity:93/375 (25%)
Similarity:146/375 (39%) Gaps:87/375 (23%)


  Fly    48 RRWTSLGNQAEGRDPHKCSS-FKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLK 111
            |.|.:|    ..||....:: |.|:.||:|........|:.|  .|...|:|:.|::.::.|:..
Zfish   167 RPWITL----RERDQMMPTAVFTVMCYNVLCDKYATRQLYGY--CPSWALNWEYRKKGIMEEITN 225

  Fly   112 LDPDILCLQEMQFDHLPVLVQRLRMGNG-------KKLAYVYKKKTGCRTDGCAIVYDSSKFELL 169
            .|.||:.|||::.:.............|       |..|.:..::.....|||.:.:.:.||.|:
Zfish   226 CDADIISLQEVETEQYYTFFLETLKDRGYDGFFCPKSRAKLVSEQERKHVDGCGVFFKTEKFALV 290

  Fly   170 DHQAVELYDQAVA-------LLNR----DNVALFARFRFK--------KQQEQQKEFVVATTHLL 215
            ....||....|:|       :|||    ||:.:......|        |...:::..:||..|:.
Zfish   291 QKHTVEFNQVAMANSEGSEVMLNRVMTKDNIGVAVLLEVKEDLFAAGLKPPPEKQLLLVANAHMH 355

  Fly   216 FNTKRSDVRCAQVERILEELQSF----------------STDTPIVLTGDFNSLPDSSPIEFLV- 263
            ::.:.|||:..|....|.||:|.                ::..||||..|.||||||..:|:|. 
Zfish   356 WDPEYSDVKLIQTMMFLSELKSIAERASGSINSSSPTSETSSIPIVLCADLNSLPDSGVVEYLSN 420

  Fly   264 -------------------------GKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWV----I 299
                                     ||||..|.:....   |::..:.||....|.|...    :
Zfish   421 GGVAENHKDFKELRYSDCLTNFSCNGKNGKPDGSITHS---FQLKSAYEGNLMPYTNYTYDFKGV 482

  Fly   300 VDYILRSLGSRSRHKLL-PLSVYSLPSINRCIGAGQIPNYRLGSDHYAL 347
            :|||..|....|...:| ||....|.. |...|.   |:..:.|||::|
Zfish   483 IDYIFFSKTHMSVLGVLGPLETQWLKD-NNITGC---PHPHIPSDHFSL 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 87/352 (25%)
cnot6lNP_001018474.1 Nuclease domain. {ECO:0000250} 1..550 93/375 (25%)
Required for interaction with cnot1, cnot3 and cnot7. {ECO:0000250} 1..148
leucine-rich repeat 32..52 CDD:275378
LRR_8 51..107 CDD:290566
LRR_4 51..91 CDD:289563
leucine-rich repeat 53..75 CDD:275378
leucine-rich repeat 76..98 CDD:275378
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..133 CDD:275378
Deadenylase_CCR4b 186..533 CDD:197339 87/352 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84135639
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.