DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and noct

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001016531.1 Gene:noct XenbaseID:XB-GENE-1014542 Length:458 Species:Xenopus tropicalis

Alignment Length:396 Identity:99/397 (25%)
Similarity:161/397 (41%) Gaps:87/397 (22%)


  Fly    15 SRIIRRSVSSQAKGASGKRKQKAKEMESS--------------HDR------------------- 46
            :|...|:|.|.....|......||.:.||              ||:                   
 Frog    83 ARSASRTVCSMGNSTSRLYSALAKTLSSSAAVSQHQELLETPDHDQSESLDPKDLLEECQVALQD 147

  Fly    47 -----NRRWTSLGNQAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLL 106
                 :|...||.|.: |..|.   ||:|:.:||||| .|.|....::..|.|.|.|:.|:..:|
 Frog   148 RPARLHRDLVSLRNDS-GSQPR---SFRVMQWNILAQ-ALGEGKDNFIMCPMEALKWEERKYLIL 207

  Fly   107 RELLKLDPDILCLQEMQ--FDHLPVLVQRLRMGNGKKLAYVYKKKTGC-------RTDGCAIVYD 162
            .|:|...||:|||||:.  ||....::.||    |.:..::.|..:.|       ..||||:.:.
 Frog   208 EEILMYQPDVLCLQEVDHYFDTFQPILSRL----GYQCTFLAKPWSPCLDVEHNNGPDGCALFFL 268

  Fly   163 SSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQ 227
            ..:|.|::...:.|   :...|..:.||:....:.   .|..:....|.|||...|.....|.||
 Frog   269 QDRFRLVNSAKIRL---SARTLKTNQVAIAETLQC---CETGRLLCFAVTHLKARTGWERFRLAQ 327

  Fly   228 VERILEELQSFS--TDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSGEGTA 290
            ...:|..|:|.:  ...|:::.||||:.|.....:.....:.:::|.       :::: |.:|.:
 Frog   328 GSDLLHNLESITEGATVPLIICGDFNAEPTEEVYKRFASSSLNLNSA-------YKLL-SEDGES 384

  Fly   291 STYQNEWVI---------VDYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYA 346
            ......|.|         :|||.     .|:|.|...|...||:..: ||..::|::...|||.:
 Frog   385 EPPYTTWKIRPTGESCHTLDYIW-----YSQHALRVNSALGLPTEEQ-IGPNRLPSFNYPSDHLS 443

  Fly   347 LGAVFT 352
            |...|:
 Frog   444 LVCDFS 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 79/301 (26%)
noctNP_001016531.1 Deadenylase_nocturnin 171..450 CDD:197330 80/305 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.