DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and angel1

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001016236.1 Gene:angel1 XenbaseID:XB-GENE-6454204 Length:566 Species:Xenopus tropicalis

Alignment Length:254 Identity:87/255 (34%)
Similarity:124/255 (49%) Gaps:27/255 (11%)


  Fly    34 KQKAKEMESSH--DRNRR-----------WTSLGNQAEGRD-PHKCSSFKVVSYNILAQDLLLEH 84
            |:|..|.:|.|  |..:.           |....|..|..| ..|...|.|:|||||:|||..::
 Frog    91 KEKPSEEDSWHLLDLEQSLPQPAMYSEFLWRDWENLCETEDISDKQFDFSVLSYNILSQDLADQN 155

  Fly    85 LFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKLAYVYKKK 149
            ..||.......|.|..|..|:|:||...:.||:||||:|.||....|:......|  .:..:|::
 Frog   156 PELYQHCDPSILHWDYRWPNILQELQHWEADIICLQEVQQDHYKEHVEPSLSAIG--YSCHFKRR 218

  Fly   150 TGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQQKE-----FVV 209
            ||.:||||...|.:.:|.||....||.:...:.:||||||.|....:......||..     ..|
 Frog   219 TGRKTDGCCTCYKTQRFMLLSESHVEFFRPGIDVLNRDNVGLVLLLKPLLPDAQQGRHNPIPLCV 283

  Fly   210 ATTHLLFNTKRSDVRCAQVERILEELQSFS-----TDTPIVLTGDFNSLPDSSPIEFLV 263
            |.||||:|.:|.|::.||:..:|.|:...|     :..|::|.||.|:.|| ||:..|:
 Frog   284 ANTHLLYNPRRGDIKLAQLALLLAEVDKISLTAHGSHYPVILCGDLNATPD-SPLYHLL 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 75/205 (37%)
angel1NP_001016236.1 EEP 141..>341 CDD:294334 75/203 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32251
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.