DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Angel2

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_067396.3 Gene:Angel2 MGIID:1196310 Length:544 Species:Mus musculus

Alignment Length:390 Identity:112/391 (29%)
Similarity:165/391 (42%) Gaps:85/391 (22%)


  Fly     6 LHNVSLKATSRIIRRS-----VSSQAKGAS----------GKRKQKAKEMESSHDRNRRWTSLGN 55
            |.|.||...||.:..|     :|.:.|...          ...|:..|::|   |||     :.:
Mouse   100 LSNASLIHLSRHVMTSDRDEPLSKRRKHQGTIKRNWEYLCSHNKENTKDLE---DRN-----VDS 156

  Fly    56 QAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQ 120
            ..|.|:..  ..|.|:|||||:||||.::..||.......|.|..|..|:|:|:...|.|:||||
Mouse   157 TCEDREDK--FDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQ 219

  Fly   121 EMQFDHL-----PVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYD 178
            |:|.||.     |.|         :.|.|  .||.|||.:.|||||.:..|:|.||....||...
Mouse   220 EVQEDHYGTEIRPSL---------ESLGYHCEYKMKTGRKPDGCAICFKHSRFSLLSVNPVEFCR 275

  Fly   179 QAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFS---- 239
            :.:.||:|||:.|....:.|..:.......:|.||||:|.:|.|::..|:..:|.|:.:.:    
Mouse   276 RDIPLLDRDNIGLVLLLQPKIPRAASPSICIANTHLLYNPRRGDIKLTQLAMLLAEIANVTHRKD 340

  Fly   240 -TDTPIVLTGDFNSLPDSSPIEFL-----------VGK-NGDVDSTACPEPLHFEI--------- 282
             :..|||:.|||||:|.|....|:           :|| :|...|:.....|...|         
Mouse   341 GSSCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIWPPNLGISQ 405

  Fly   283 -----------IDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYS-------LPSINRC 329
                       ::..:...:..|.|...|......:.|..:|.....||||       :|.:..|
Mouse   406 NCVYEAQQVPKVEKTDSDVTQAQQEKAEVPVSADKVSSHLQHGFSLSSVYSHYVPDTGVPEVTTC 470

  Fly   330  329
            Mouse   471  470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 94/312 (30%)
Angel2NP_067396.3 EEP 169..542 CDD:294334 94/312 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84063625
eggNOG 1 0.900 E1_COG5239
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 1 1.000 T615897
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3577
TreeFam 1 0.960
98.830

Return to query results.
Submit another query.