| Sequence 1: | NP_477204.1 | Gene: | angel / 37748 | FlyBaseID: | FBgn0016762 | Length: | 354 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_067396.3 | Gene: | Angel2 / 52477 | MGIID: | 1196310 | Length: | 544 | Species: | Mus musculus |
| Alignment Length: | 390 | Identity: | 112/390 - (28%) |
|---|---|---|---|
| Similarity: | 165/390 - (42%) | Gaps: | 85/390 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 LHNVSLKATSRIIRRS-----VSSQAKGAS----------GKRKQKAKEMESSHDRNRRWTSLGN 55
Fly 56 QAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQ 120
Fly 121 EMQFDHL-----PVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYD 178
Fly 179 QAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFS---- 239
Fly 240 -TDTPIVLTGDFNSLPDSSPIEFL-----------VGK-NGDVDSTACPEPLHFEI--------- 282
Fly 283 -----------IDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYS-------LPSINRC 329
Fly 330 329 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| angel | NP_477204.1 | EEP | 70..351 | CDD:294334 | 94/311 (30%) |
| Angel2 | NP_067396.3 | EEP | 169..542 | CDD:294334 | 94/311 (30%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167833976 | |
| Domainoid | 1 | 1.000 | 136 | 1.000 | Domainoid score | I4910 |
| eggNOG | 1 | 0.900 | - | - | E1_COG5239 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0002618 | |
| OrthoInspector | 1 | 1.000 | - | - | otm42397 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_105310 | |
| Panther | 1 | 1.100 | - | - | O | PTHR12121 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3577 |
| SonicParanoid | 1 | 1.000 | - | - | X1517 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 12 | 11.730 | |||||