DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Lrrc27

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001137228.1 Gene:Lrrc27 RGDID:1559981 Length:513 Species:Rattus norvegicus

Alignment Length:151 Identity:30/152 (20%)
Similarity:58/152 (38%) Gaps:21/152 (14%)


  Fly    98 WQRRQQNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYD 162
            |..:::  :|...||..:|:..::::.....:|...| ..|.|  |.:..|:..||.....:...
  Rat   247 WPSKEE--IRRFWKLRQEIVENEQVEVQENKLLAVEL-PPNLK--AAINAKERKCRKPWPTLRKR 306

  Fly   163 SSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQ 227
            |:.|..:.......|...|.....|:....|   |::.||:::         :...:|.|.|..|
  Rat   307 STSFRGILPNLSSTYQNTVHTKRMDDTHKMA---FQELQEKER---------MLEQQRRDKRALQ 359

  Fly   228 VER----ILEELQSFSTDTPI 244
            ..|    ::...:.||...|:
  Rat   360 DWREQTQLMRHRREFSKFQPL 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 30/152 (20%)
Lrrc27NP_001137228.1 leucine-rich repeat 50..69 CDD:275378
LRR_8 68..127 CDD:290566
LRR_4 68..109 CDD:289563
leucine-rich repeat 70..93 CDD:275378
LRR_4 92..131 CDD:289563
leucine-rich repeat 94..116 CDD:275378
leucine-rich repeat 117..139 CDD:275378
leucine-rich repeat 140..151 CDD:275378
DUF106 <321..>380 CDD:303007 15/71 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.