DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and cu

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001097746.1 Gene:cu FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster

Alignment Length:339 Identity:89/340 (26%)
Similarity:146/340 (43%) Gaps:77/340 (23%)


  Fly    58 EGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEM 122
            ||.|      .:::.:|||:| .|.:|...:|..|.|.|:|:.|:..:::|:|:..||::||||:
  Fly   307 EGDD------IRLLQWNILSQ-TLGQHNDGFVRCPEEALTWEHRKYLIVQEILQNQPDVICLQEV 364

  Fly   123 QFDHLPVLVQRLRMGNGKKLAYVYKKKTGC-------RTDGCAIVYDSSKFEL--LDHQAVELYD 178
              ||...|...|...|...: :..|..:.|       ..|||||.|...|.:|  .|.:.:|:: 
  Fly   365 --DHFKFLQTVLGSQNYAGI-FFPKPDSPCLYIEQNNGPDGCAIFYKRDKLQLQGYDTRILEVW- 425

  Fly   179 QAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHL--LFNTKRSDVRCAQVERILEELQSFSTD 241
                .:..:.||:.||.|.:   ...:||.||||||  ......:.:|..|...::..::.|:.|
  Fly   426 ----RVQSNQVAIAARLRMR---SSGREFCVATTHLKARHGALLAKLRNEQGRDLIRFVKQFAGD 483

  Fly   242 TPIVLTGDFNSLPDSSPIEFLVG------KNGDVDSTACPEPLHFEIIDSGEGTASTYQNE---- 296
            ||::|.||||:.|.......::|      .:...|.....|.:.....|.||..|.:.:.|    
  Fly   484 TPLLLCGDFNAEPVEPIYATILGCDLLRLGSAYADVKLDREEILHPNADVGEFVAKSMKREPPYT 548

  Fly   297 -WVI---------VDYILRSLGSRSRHKLLPLSVYSLP---SINRC--------IGAGQIPNYRL 340
             |.|         :||                 |:..|   .|..|        ||..:.|:::.
  Fly   549 TWKIREEGEECHTIDY-----------------VFYTPDRLKIKNCLDFPAGEQIGKNRTPSFQY 596

  Fly   341 GSDHYALGAVFTVV 354
            .|||::|...|.::
  Fly   597 PSDHFSLVCDFELL 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 85/323 (26%)
cuNP_001097746.1 EEP 312..609 CDD:294334 86/326 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84192780
eggNOG 1 0.900 E1_COG5239
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12121
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.