DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Cnot6l

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_008768264.1 Gene:Cnot6l RGDID:1309128 Length:560 Species:Rattus norvegicus

Alignment Length:388 Identity:100/389 (26%)
Similarity:152/389 (39%) Gaps:115/389 (30%)


  Fly    48 RRWTSLGNQAEGRD---PHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLREL 109
            |.|.:|    :.||   |  .:||.|:.||:|........|:.|  .|...|:|:.|::.::.|:
  Rat   177 RPWITL----KERDQILP--SASFTVMCYNVLCDKYATRQLYGY--CPSWALNWEYRKKGIMEEI 233

  Fly   110 LKLDPDILCLQEMQFDH-----LPVLVQRLRMG--NGKKLAYVYKKKTGCRTDGCAIVYDSSKFE 167
            :..|.||:.|||::.:.     ||.|..|...|  :.|..|.:..::.....|||||.:.:.||.
  Rat   234 VNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFT 298

  Fly   168 LLDHQAVEL-------YDQAVALLNR----DNVALFARFRFKKQ----------QEQQKEFVVAT 211
            |:....||.       .|.:.|:|||    ||:.:.......|:          ...::..:||.
  Rat   299 LVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVAN 363

  Fly   212 THLLFNTKRSDVRCAQ-------VERILEELQS-------FSTDTPIVLTGDFNSLPDSSPIEFL 262
            .|:.::.:.|||:..|       |:.|||:..|       .....|:||..|.||||||..:|:|
  Rat   364 AHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYL 428

  Fly   263 --------------------------VGKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWV--- 298
                                      .||||..:..          |..|....|.|:|..:   
  Rat   429 SNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGR----------ITHGFQLKSAYENNLMPYT 483

  Fly   299 --------IVDYILRS------LGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYAL 347
                    ::|||..|      ||     .|.||....|.. |...|.   |:..:.|||::|
  Rat   484 NYTFDFKGVIDYIFYSKTHMNVLG-----VLGPLDPQWLVE-NNITGC---PHPHIPSDHFSL 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 92/364 (25%)
Cnot6lXP_008768264.1 leucine-rich repeat 43..62 CDD:275378
LRR_8 61..119 CDD:290566
LRR_4 61..101 CDD:289563
leucine-rich repeat 63..85 CDD:275378
LRR_4 85..123 CDD:289563
leucine-rich repeat 86..108 CDD:275378
leucine-rich repeat 109..131 CDD:275378
leucine-rich repeat 132..143 CDD:275378
Deadenylase_CCR4b 196..543 CDD:197339 92/364 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84140993
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.