DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and CG31759

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_723735.2 Gene:CG31759 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster

Alignment Length:407 Identity:92/408 (23%)
Similarity:150/408 (37%) Gaps:111/408 (27%)


  Fly    10 SLKATSRIIRRSVSSQAKGASGKRKQKAKEMESSHDRNRRWT-SLGNQAEGRDPHKCSSFKVVSY 73
            :|..|..::.:..:|..:.:.|:.        ...||.|..| ||....|         .:||||
  Fly   195 ALGMTGPVVEKITNSAVQESPGRC--------PFQDRQRHTTNSLSESNE---------IRVVSY 242

  Fly    74 NILA-----QDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEM-----QFDHLP 128
            |:||     .|.....||.|  .|.::|....|:...:.|::..:.|||||||:     .||...
  Fly   243 NLLADLYASSDYAGSTLFSY--CPAKYLQIDYRKPLFINEIIGYNSDILCLQEVDQRIFDFDLKE 305

  Fly   129 VLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFA 193
            :|.|.....:|     :...|..| .:|.||.:.:|:|:|||.|.:.|.....||...:  :|:.
  Fly   306 ILEQPPYNYHG-----IMAPKGKC-AEGVAIFFRNSRFDLLDSQILHLGSNIPALPVFE--SLWN 362

  Fly   194 RFRFKKQQEQQ-------------------KEFVVATTHLLFNTKRSDVRCAQV--------ERI 231
            :.:...|..::                   ...:||.|||.|:.....:|..|:        :.|
  Fly   363 KIKVNAQLAERICERSTTLQTCLLRIKGTDNYVLVANTHLYFHPDADHIRLLQMGFSMLFVEQSI 427

  Fly   232 LEELQSFSTDT----PIVLTGDFNSLPDSSPIEFLVGKNG-----DVDSTA-------------- 273
            .:.::.|:..:    .::..|||||:|:....:.:..:..     |..|.|              
  Fly   428 SKAIKDFNISSHKNIGLIFCGDFNSVPECGIYKLMTEQLAEKTLEDWQSNAEQAVSNVELAQPFK 492

  Fly   274 ------CPEPLHFEIIDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYSLPSINRCIGA 332
                  .||..|:..:.:|......|||:                 :...|.|..||:.......
  Fly   493 MASAYGAPEYTHYTTLFAGCLDYVFYQND-----------------RFEVLKVVPLPTEEELKAN 540

  Fly   333 GQIPNYRLGSDHYALGA 349
            ..||:....|||.||.|
  Fly   541 TAIPSAVFPSDHVALVA 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 81/347 (23%)
CG31759NP_723735.2 EEP 239..561 CDD:294334 81/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84036356
eggNOG 1 0.900 E1_COG5239
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12121
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.