DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Noct

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_612535.1 Gene:Noct RGDID:1587344 Length:428 Species:Rattus norvegicus

Alignment Length:312 Identity:89/313 (28%)
Similarity:142/313 (45%) Gaps:49/313 (16%)


  Fly    65 CSS----FKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQ-- 123
            |||    .:|:.:||||| .|.|....:|..|.|.|.|:.|:..:|.|:|...||||||||:.  
  Rat   133 CSSSHPPIRVMQWNILAQ-ALGEGKDNFVQCPVEALKWEERKCLILEEILAYQPDILCLQEVDHY 196

  Fly   124 FDHLPVLVQRLRMGNGKKLAYVYKKKTGC-------RTDGCAIVYDSSKFELLDHQAVELYDQAV 181
            ||....|:.||    |.:..:..|..:.|       ..||||:.:..|:|:|::...:.|   ..
  Rat   197 FDTFQPLLSRL----GYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQSRFKLINSTNIRL---TA 254

  Fly   182 ALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFS--TDTPI 244
            ..|..:.||:......|   |..::|.:|.|||...|.....|.||...:|:.||:.:  ...|:
  Rat   255 MTLKTNQVAIAQTLECK---ESGRQFCIAVTHLKARTGWERFRSAQGCDLLQNLQNITEGAKIPL 316

  Fly   245 VLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWVI---------V 300
            ::.||||:.|.....:.....:.:::|.       :::: |.:|.:......|.|         :
  Rat   317 IVCGDFNAEPTEEVYKHFASSSLNLNSA-------YKLL-SPDGQSEPPYTTWKIRTSGECRHTL 373

  Fly   301 DYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGAVFT 352
            |||.     .|||.|...|...|.:..: ||..::|::...|||.:|...|:
  Rat   374 DYIW-----YSRHALSVTSALDLLTEEQ-IGPNRLPSFHYPSDHLSLVCDFS 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 85/301 (28%)
NoctNP_612535.1 Deadenylase_nocturnin 141..420 CDD:197330 86/305 (28%)
Interaction with PPARG. {ECO:0000250|UniProtKB:O35710} 340..350 2/18 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5046
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.