DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Angel2

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001128591.2 Gene:Angel2 RGDID:1305056 Length:522 Species:Rattus norvegicus

Alignment Length:390 Identity:116/391 (30%)
Similarity:165/391 (42%) Gaps:85/391 (22%)


  Fly     6 LHNVSLKATSRII----RRSVSSQAKGASG--KR---------KQKAKEMESSHDRNRRWTSLGN 55
            |.|.||...||.:    |...||:.:...|  ||         |:|.|::|   |||       .
  Rat    78 LSNTSLFHLSRYVMNSDRDEPSSKRRKHQGTIKRSWEYLCSHNKEKTKDLE---DRN-------G 132

  Fly    56 QAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQ 120
            .:...|......|.|:|||||:|:||.::..||.......|.|..|..|:|:|:...|.|:||||
  Rat   133 DSTCEDCEDKFDFSVMSYNILSQELLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQ 197

  Fly   121 EMQFDHL-----PVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYD 178
            |:|.||.     |.|         :.|.|  .||.|||.:.|||||.:..|||.||....||...
  Rat   198 EVQEDHYGTEIRPSL---------ESLGYHCEYKMKTGRKPDGCAICFKHSKFSLLSVNPVEFCR 253

  Fly   179 QAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEEL-----QSF 238
            :.:.||:|||:.|....:.|..:.......:|.||||:|.:|.|::..|:..:|.|:     |..
  Rat   254 RDIPLLDRDNIGLVLLLQPKIPRAASPSICIANTHLLYNPRRGDIKLTQLAMLLAEISNVAHQKD 318

  Fly   239 STDTPIVLTGDFNSLPDSSPIEFL-----------VGK-NGDVDSTACPEPLHFEI--------- 282
            .:..|||:.|||||:|.|....|:           :|| :|...|:.....|...|         
  Rat   319 GSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIWPPNLGISQ 383

  Fly   283 -----------IDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYS-------LPSINRC 329
                       ::..:...:..|.|...|......:.|..:|.....||||       :|.:..|
  Rat   384 NCVYEAQQVPKVEKTDSDVTQAQQEKAEVPVPADKVSSHLQHGFSLSSVYSHYVPDTGVPEVTTC 448

  Fly   330  329
              Rat   449  448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 95/312 (30%)
Angel2NP_001128591.2 EEP 147..520 CDD:294334 95/312 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84064130
eggNOG 1 0.900 E1_COG5239
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 1 1.000 T618009
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12121
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.900

Return to query results.
Submit another query.