DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Cnot6

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_017452562.1 Gene:Cnot6 RGDID:1310783 Length:564 Species:Rattus norvegicus

Alignment Length:455 Identity:109/456 (24%)
Similarity:173/456 (38%) Gaps:144/456 (32%)


  Fly     6 LHNVSLKA---TSRII---------RRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLGNQAE 58
            |..:|||.   |..|:         ||.::......||    .||.:.:.....|.|:...|:.|
  Rat   122 LQTLSLKGNPLTQDILNLCLEPDGTRRLLNYLLDNLSG----TAKRIPTEQTPPRSWSCYKNRHE 182

  Fly    59 -GRDPH---KCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCL 119
             |:...   ..:.|.|:.||:|........|:.|  .|...|:|..|::.:::|:|..:.||:.|
  Rat   183 QGQQVEVIFPTALFSVMCYNVLCDKYATRQLYGY--CPSWALNWDYRKKAIIQEILSCNADIISL 245

  Fly   120 QEMQFD--HLPVLVQRLRMG-NGKKLAYVYKKKTGCRT---------DGCAIVYDSSKFELLDHQ 172
            ||::.:  :...||:....| ||     .:..|:..||         |||||.:.:.||.|:...
  Rat   246 QEVETEQYYSFFLVELKERGYNG-----FFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKH 305

  Fly   173 AVELYDQAV-------ALLNR----DNVALFARFRFKKQQEQ----------QKEFV-VATTHLL 215
            .||....|:       |:|||    ||:.:......:|:..:          :|:.: ||..|:.
  Rat   306 TVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMH 370

  Fly   216 FNTKRSDVRCAQVERILEELQSFSTDT---------------PIVLTGDFNSLPDSSPIEFLV-- 263
            ::.:.|||:..|....|.|:::.....               |:||..|.||||||..:|:|.  
  Rat   371 WDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTG 435

  Fly   264 ------------------------GKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWV------ 298
                                    ||||..:..          |..|....|.|:|..:      
  Rat   436 GVETNHKDFKELRYNESLTNFSCNGKNGMTNGR----------ITHGFKLKSAYENGLMPYTNYT 490

  Fly   299 -----IVDYILRS---------LGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGA 349
                 |:|||..|         ||....|.|:.      .:|:.|      |:..:.|||::|.|
  Rat   491 FDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVE------NNISGC------PHPLIPSDHFSLFA 543

  Fly   350  349
              Rat   544  543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 91/376 (24%)
Cnot6XP_017452562.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84185420
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.