DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and CNOT6L

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_011530108.1 Gene:CNOT6L HGNCID:18042 Length:602 Species:Homo sapiens

Alignment Length:396 Identity:100/397 (25%)
Similarity:151/397 (38%) Gaps:123/397 (31%)


  Fly    48 RRWTSLGNQAEGRD---PHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLREL 109
            |.|.:|    :.||   |  .:||.|:.||:|........|:.|  .|...|:|:.|::.::.|:
Human   211 RPWITL----KERDQILP--SASFTVMCYNVLCDKYATRQLYGY--CPSWALNWEYRKKGIMEEI 267

  Fly   110 LKLDPDILCLQEMQF-------------DHLPVLVQRLRMG--NGKKLAYVYKKKTGCRTDGCAI 159
            :..|.||:.||.:.|             ..||.|.:|...|  :.|..|.:..::.....|||||
Human   268 VNCDADIISLQMITFLSSQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAI 332

  Fly   160 VYDSSKFELLDHQAVEL-------YDQAVALLNR----DNVALFARFRFKKQ----------QEQ 203
            .:.:.||.|:....||.       .|.:.|:|||    ||:.:.......|:          ...
Human   333 FFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAAD 397

  Fly   204 QKEFVVATTHLLFNTKRSDVRCAQ-------VERILEELQS-------FSTDTPIVLTGDFNSLP 254
            ::..:||..|:.::.:.|||:..|       |:.|||:..|       .....|:||..|.||||
Human   398 KQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLP 462

  Fly   255 DSSPIEFLV--------------------------GKNGDVDSTACPEPLHFEIIDSGEGTASTY 293
            ||..:|:|.                          ||||..:..          |..|....|.|
Human   463 DSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGR----------ITHGFQLKSAY 517

  Fly   294 QNEWV-----------IVDYILRS------LGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLG 341
            :|..:           ::|||..|      ||     .|.||....|.. |...|.   |:..:.
Human   518 ENNLMPYTNYTFDFKGVIDYIFYSKTHMNVLG-----VLGPLDPQWLVE-NNITGC---PHPHIP 573

  Fly   342 SDHYAL 347
            |||::|
Human   574 SDHFSL 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 92/372 (25%)
CNOT6LXP_011530108.1 LRR_8 95..176 CDD:290566
LRR_4 95..135 CDD:289563
leucine-rich repeat 97..119 CDD:275380
leucine-rich repeat 120..165 CDD:275380
Deadenylase_CCR4b 230..585 CDD:197339 92/372 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84140892
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.