DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and ANGEL1

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001357675.1 Gene:ANGEL1 HGNCID:19961 Length:744 Species:Homo sapiens

Alignment Length:300 Identity:104/300 (35%)
Similarity:143/300 (48%) Gaps:37/300 (12%)


  Fly    48 RRWTSLGNQAE------GRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLL 106
            |.|.....|.:      |..|.  ..|.::|||||||||:.:...||:....:.|:|..|..||:
Human   221 REWEDFSTQPDAQGLKAGDGPQ--FQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFVNLM 283

  Fly   107 RELLKLDPDILCLQEMQFDHL-PVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLD 170
            :|....|||||||||:|.||. ..|...|||   ......||::|||:|||||:.|..::|.||.
Human   284 QEFQHWDPDILCLQEVQEDHYWEQLEPSLRM---MGFTCFYKRRTGCKTDGCAVCYKPTRFRLLC 345

  Fly   171 HQAVELYDQAVALLNRDNVALFARFR----FKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERI 231
            ...||.:...:.|||||||.|....:    ....|.......||.||:|:|.:|.||:.||:..:
Human   346 ASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAIL 410

  Fly   232 LEELQ-----SFSTDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSGE--GT 289
            |.|:.     |..:..||:|.||.||:|||....|:  ::|::.....|......::...|  ||
Human   411 LAEVDKVARLSDGSHCPIILCGDLNSVPDSPLYNFI--RDGELQYHGMPAWKSLALLPRLECNGT 473

  Fly   290 ASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYSLPSINRC 329
            .|.:.|        |..|||...    |.|...:..|..|
Human   474 ISAHCN--------LCLLGSCDS----PASASQVAGITGC 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 98/272 (36%)
ANGEL1NP_001357675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84175266
eggNOG 1 0.900 E1_COG5239
Hieranoid 1 1.000
Homologene 1 1.000 H32251
Inparanoid 1 1.050 134 1.000 Inparanoid score I4513
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 1 1.000 T609071
orthoMCL 1 0.900 OOG5_135948
Panther 1 1.100 LDO PTHR12121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3577
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.