DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Cnot6l

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_849185.2 Gene:Cnot6l MGIID:2443154 Length:555 Species:Mus musculus

Alignment Length:388 Identity:100/389 (26%)
Similarity:152/389 (39%) Gaps:115/389 (30%)


  Fly    48 RRWTSLGNQAEGRD---PHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLREL 109
            |.|.:|    :.||   |  .:||.|:.||:|........|:.|  .|...|:|:.|::.::.|:
Mouse   172 RPWITL----KERDQILP--SASFTVMCYNVLCDKYATRQLYGY--CPSWALNWEYRKKGIMEEI 228

  Fly   110 LKLDPDILCLQEMQFDH-----LPVLVQRLRMG--NGKKLAYVYKKKTGCRTDGCAIVYDSSKFE 167
            :..|.||:.|||::.:.     ||.|..|...|  :.|..|.:..::.....|||||.:.:.||.
Mouse   229 VNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFT 293

  Fly   168 LLDHQAVEL-------YDQAVALLNR----DNVALFARFRFKKQ----------QEQQKEFVVAT 211
            |:....||.       .|.:.|:|||    ||:.:.......|:          ...::..:||.
Mouse   294 LVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVAN 358

  Fly   212 THLLFNTKRSDVRCAQ-------VERILEELQS-------FSTDTPIVLTGDFNSLPDSSPIEFL 262
            .|:.::.:.|||:..|       |:.|||:..|       .....|:||..|.||||||..:|:|
Mouse   359 AHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYL 423

  Fly   263 --------------------------VGKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWV--- 298
                                      .||||..:..          |..|....|.|:|..:   
Mouse   424 SNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGR----------ITHGFQLKSAYENNLMPYT 478

  Fly   299 --------IVDYILRS------LGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYAL 347
                    ::|||..|      ||     .|.||....|.. |...|.   |:..:.|||::|
Mouse   479 NYTFDFKGVIDYIFYSKTHMNVLG-----VLGPLDPQWLVE-NNITGC---PHPHIPSDHFSL 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 92/364 (25%)
Cnot6lNP_849185.2 leucine-rich repeat 81..103 CDD:275378
leucine-rich repeat 104..126 CDD:275378
leucine-rich repeat 127..138 CDD:275378
Nuclease domain. {ECO:0000250} 158..555 100/389 (26%)
Deadenylase_CCR4b 191..538 CDD:197339 92/364 (25%)
Required for interaction with CNOT1, CNOT3 and CNOT7. {ECO:0000250} 1..152
leucine-rich repeat 38..57 CDD:275378
LRR <57..>183 CDD:227223 5/15 (33%)
leucine-rich repeat 58..80 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84140427
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.