DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and angl-1

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001303707.1 Gene:angl-1 WormBaseID:WBGene00020955 Length:520 Species:Caenorhabditis elegans

Alignment Length:260 Identity:86/261 (33%)
Similarity:130/261 (50%) Gaps:26/261 (10%)


  Fly    23 SSQAKGASGKRKQKAKEMESSHDRN--------RRWTSLGNQAEGRDPHKCSSFKVVSYNILAQD 79
            ||.:..::|..:|..|::.....|:        |.|.....|:..:.|...|.|.:.|||:|.|.
 Worm   223 SSSSPSSTGTTQQTFKKINDGFSRDCKDFKRLVRCWNRTEAQSRSKIPKISSKFTICSYNVLCQK 287

  Fly    80 LL--LEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKL 142
            .:  .::|:.::....:||.|:.|.:.|..||...|.|||.|||:|.||.....|.|.    ||.
 Worm   288 TIARTDYLYRHLQGSAQFLDWEHRWRGLQVELPTFDADILGLQEVQADHFVEHFQPLM----KKY 348

  Fly   143 AY--VYKKKTGC--RTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQ 203
            .|  |||:|.|.  :.||||:.|..:||||:.:|.|..:....|:.||:|:|.....|.:..:|.
 Worm   349 GYEGVYKQKFGTQQKDDGCALFYHPAKFELVANQEVNYFISDTAISNRENIAQIVALRCRITKEL 413

  Fly   204 QKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFSTD-----TPIVLTGDFNSLPDSSPIEFLV 263
               .:||.||||||.:|.||:.||:..:...:.....|     .|:.:.||||..|:|...:|:|
 Worm   414 ---ILVANTHLLFNEERGDVKLAQLAILFASIHKMREDFAPMVPPVFVMGDFNIEPNSKVYDFIV 475

  Fly   264  263
             Worm   476  475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 74/206 (36%)
angl-1NP_001303707.1 EEP 280..>478 CDD:294334 74/204 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134643059
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3242
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 1 1.000 T474838
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12121
Phylome 1 0.910 0.938 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3577
TreeFam 1 0.960
1110.900

Return to query results.
Submit another query.