DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and ccr-4

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001129877.1 Gene:ccr-4 WormBaseID:WBGene00000376 Length:677 Species:Caenorhabditis elegans

Alignment Length:387 Identity:93/388 (24%)
Similarity:160/388 (41%) Gaps:100/388 (26%)


  Fly    48 RRWTSLGNQAEGRDPHK-CSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLK 111
            |.|..:.:    .||.: .::|.|:.||:|.......:.:.|  .|...|:|:.|:..:::|:..
 Worm   274 RNWVMIRH----ADPERPIATFTVLCYNVLCDKYATVNQYSY--CPSWALNWEYRKGLIIKEIRT 332

  Fly   112 LDPDILCLQEMQFDHLPVLVQRLRMGNGKKLAY--VYKKKTGCRT---------DGCAIVYDSSK 165
            .:.|::.|||::.:....|.|    ...|:|.|  :::.|:..:|         |||||.:...|
 Worm   333 YEADVITLQEVETEQFRTLFQ----PELKQLGYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDK 393

  Fly   166 FELLDHQ--------AVELYDQAVALLN----RDNVALFARFRFKKQQEQQK------------- 205
            |: :|.|        |::....:..:||    |||:.|.|..:.|:.....|             
 Worm   394 FD-MDKQYLFEFSSVAMKKASTSENMLNRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNV 457

  Fly   206 ---EFVVATTHLLFNTKRSDVRCAQ-------VERILEEL----QSFSTDTPIVLTGDFNSLPDS 256
               ..||||.|:.::.:..||:..|       |.|:|||:    |......|:::.|||||||||
 Worm   458 VGNPLVVATAHIHWDPEFCDVKLVQSMMLTHEVSRVLEEVSKKYQITQQQVPVLICGDFNSLPDS 522

  Fly   257 SPIEFLVGKNGDV-----------------------DSTACPEPLHFE-IIDSGEGTASTYQNEW 297
            ...|:|  ..|.:                       |......||..: ..|......:.|..::
 Worm   523 GVFEYL--SKGQITRRHMDLKSFRDDSCLEKFTNSTDKNVISHPLRLDSACDINSIPFTNYTLDF 585

  Fly   298 V-IVDYILRSLGSRSRHKLL----PLSVYSLPSINRCIGAGQIPNYRLGSDHYALGAVFTVV 354
            . ::|||..:..|.:|..:|    |..|.|    |:.:|   .|:..:.|||..:.|.:.::
 Worm   586 KGMIDYIFATPQSLARLGILGPFDPQWVQS----NKILG---FPHPHVASDHIPIMAQYAII 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 88/360 (24%)
ccr-4NP_001129877.1 Deadenylase_CCR4 293..639 CDD:197331 88/362 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.