DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and Noct

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_033964.1 Gene:Noct MGIID:109382 Length:429 Species:Mus musculus

Alignment Length:400 Identity:103/400 (26%)
Similarity:162/400 (41%) Gaps:78/400 (20%)


  Fly     6 LHNVSLKATSRIIRRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLGNQAEGRDP-------- 62
            |...:....:|...|:|||...|.|......||.:.||.........:....|..:|        
Mouse    46 LQAAAASGAARSRPRTVSSMGNGTSRLYSALAKTVNSSAAAQHPEYLVSTDPEHLEPIDPKELLE 110

  Fly    63 ------H---------------KCSS----FKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQ 102
                  |               .|||    .:|:.:||||| .|.|....:|..|.|.|.|:.|:
Mouse   111 ECRAVLHTRPPRYQRDFVDLRTDCSSSHSPIRVMQWNILAQ-ALGEGKDNFVQCPVEALKWEERK 174

  Fly   103 QNLLRELLKLDPDILCLQEMQ--FDHLPVLVQRLRMGNGKKLAYVYKKKTGC-------RTDGCA 158
            ..:|.|:|...||||||||:.  ||....|:.||    |.:..:..|..:.|       ..||||
Mouse   175 CLILEEILAYQPDILCLQEVDHYFDTFQPLLSRL----GYQGTFFPKPWSPCLDVEHNNGPDGCA 235

  Fly   159 IVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDV 223
            :.:..::|:|:....:.|   ....|..:.||:......|   |..::|.:|.|||...|.....
Mouse   236 LFFLQNRFKLISSTNIRL---TAMTLKTNQVAIAQTLECK---ESGRQFCIAVTHLKARTGWERF 294

  Fly   224 RCAQVERILEELQSFS--TDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSG 286
            |.||...:|:.||:.:  ...|:::.||||:.|.....:.....:.:::|.       :::: |.
Mouse   295 RSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSA-------YKLL-SP 351

  Fly   287 EGTASTYQNEWVI---------VDYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGS 342
            :|.:......|.|         :|||.     .|||.|...|...|.:..: ||..::|::...|
Mouse   352 DGQSEPPYTTWKIRTSGECRHTLDYIW-----YSRHALSVTSALDLLTEEQ-IGPNRLPSFHYPS 410

  Fly   343 DHYALGAVFT 352
            ||.:|...|:
Mouse   411 DHLSLVCDFS 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 84/301 (28%)
NoctNP_033964.1 Deadenylase_nocturnin 142..421 CDD:197330 85/304 (28%)
Interaction with PPARG. {ECO:0000269|PubMed:20498072} 341..351 2/18 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.