DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and angel2

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002934749.2 Gene:angel2 / 100379750 XenbaseID:XB-GENE-985562 Length:526 Species:Xenopus tropicalis


Alignment Length:340 Identity:111/340 - (32%)
Similarity:166/340 - (48%) Gaps:61/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NRRW---------TSLGNQAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQ 102
            :|||         .|..|:..|||| :...|.|:|||||:||||.::..||.......|.|..|.
 Frog   127 SRRWEDFNLYYSELSKWNRVFGRDP-EYFDFTVLSYNILSQDLLEDNSHLYDHCRRPLLFWSYRL 190

  Fly   103 QNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSK 165
            .|:|:||:.|:.|||||||:|.||....::    .:.:.|.|  .||.:||.:.|||||.:.::|
 Frog   191 PNILKELVDLNADILCLQEVQEDHYTTQIK----PSLESLGYHCEYKTRTGSKPDGCAICFKANK 251

  Fly   166 FELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVER 230
            |.|:....||.|...::||:|||:.|....| .|.|.......||.||||:|.:|.|::.||:..
 Frog   252 FSLVSVTPVEYYRPNISLLDRDNIGLVLLLR-PKSQRVAPVICVANTHLLYNPRRGDIKLAQLAI 315

  Fly   231 ILEELQS--FSTD---TPIVLTGDFNSLPDSSPIEFL-----------VGK-NGDVDSTACPEPL 278
            :|.|:.|  |:.:   .||||.|||||:|.|....|:           :|| :|........:.|
 Frog   316 LLAEITSVAFTGEKGFCPIVLCGDFNSVPGSPLHSFIREGRLNYEGLSIGKVSGQEQYPRGQKIL 380

  Fly   279 HFEIIDSGEGTAST-----YQNEWVIVDYI-LRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPN 337
            ...|.....|.:..     .:|.|...:.: ..|:|:.:|::.:.      ||:           
 Frog   381 SIPIWPKSLGISQNCVYEPMENAWNAAEMVDKESVGNSARNRQVE------PSL----------- 428

  Fly   338 YRLGSDHYALGAVFT 352
                |.|::|.:|:|
 Frog   429 ----SHHFSLSSVYT 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 99/305 (32%)
angel2XP_002934749.2 PLN03144 <148..523 CDD:178689 106/319 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5026
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395901at33208
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - otm47505
Panther 1 1.100 - - O PTHR12121
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.020

Return to query results.
Submit another query.