DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and angel2

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002934749.1 Gene:angel2 XenbaseID:XB-GENE-985562 Length:526 Species:Xenopus tropicalis

Alignment Length:340 Identity:110/341 (32%)
Similarity:166/341 (49%) Gaps:61/341 (18%)


  Fly    47 NRRW---------TSLGNQAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQ 102
            :|||         .|..|:..|||| :...|.|:|||||:||||.::..||.......|.|..|.
 Frog   127 SRRWEDFNLYYSELSKWNRVFGRDP-EYFDFTVLSYNILSQDLLEDNSHLYDHCRRPLLFWSYRL 190

  Fly   103 QNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSK 165
            .|:|:||:.::.|||||||:|.||....::    .:.:.|.|  .||.:||.:.|||||.:.::|
 Frog   191 PNILKELVDMNADILCLQEVQEDHYTTQIK----PSLESLGYHCEYKTRTGSKPDGCAICFKANK 251

  Fly   166 FELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVER 230
            |.|:....||.|...::||:|||:.|....| .|.|.......||.||||:|.:|.|::.||:..
 Frog   252 FSLVSVTPVEYYRPNISLLDRDNIGLVLLLR-PKSQRVAPVICVANTHLLYNPRRGDIKLAQLAI 315

  Fly   231 ILEELQS--FSTD---TPIVLTGDFNSLPDSSPIEFL-----------VGK-NGDVDSTACPEPL 278
            :|.|:.|  |:.:   .||||.|||||:|.|....|:           :|| :|........:.|
 Frog   316 LLAEITSVAFTGEKGFCPIVLCGDFNSVPGSPLHSFIREGRLNYEGLSIGKVSGQEQYPRGQKIL 380

  Fly   279 HFEIIDSGEGTAST-----YQNEWVIVDYI-LRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPN 337
            ...|.....|.:..     .:|.|...:.: ..|:|:.:|::.:.      ||:           
 Frog   381 SIPIWPKSLGISQNCVYEPMENAWNAAEMVDKESVGNSARNRQVE------PSL----------- 428

  Fly   338 YRLGSDHYALGAVFT 352
                |.|::|.:|:|
 Frog   429 ----SHHFSLSSVYT 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 99/306 (32%)
angel2XP_002934749.1 EEP 158..524 CDD:294334 100/309 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84063090
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.