DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and cnot6l

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001120421.1 Gene:cnot6l XenbaseID:XB-GENE-977551 Length:523 Species:Xenopus tropicalis

Alignment Length:339 Identity:84/340 (25%)
Similarity:131/340 (39%) Gaps:96/340 (28%)


  Fly    48 RRWTSLGNQAEGRDPHKCS-SFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLK 111
            |.|.:|    :.||....| ||.|:.:|:|........|:.|  .|...|:|:.|::.::.|::.
 Frog   167 RPWITL----KERDQILPSVSFTVMCFNVLCDKYATRQLYGY--CPSWALNWEYRKKGIMEEIVS 225

  Fly   112 LDPDILCLQEMQFDH-----LPVLVQRLRMG--NGKKLAYVYKKKTGCRTDGCAIVYDSSKFELL 169
            .|.||:.|||::.:.     :|.|.:|...|  :.|..|.:...:.....|||||.:.:.||.|:
 Frog   226 CDADIISLQEVETEQYYTLFMPALKERGYDGFFSPKSRAKIMSDQEKKHVDGCAIFFRTEKFSLV 290

  Fly   170 DHQAVELYDQAV-------ALLNR----DNVALFARFRFKK----------QQEQQKEFVVATTH 213
            ....||....|:       |:|||    ||:.:.......|          ...:::..:||..|
 Frog   291 QKHTVEFNQIAMANSEGSEAMLNRVMTKDNIGVTVLLELHKDLSGAGMKPHHSSEKQLLMVANAH 355

  Fly   214 LLFNTKRSDVRCAQVERILEELQSF--------------STDTPIVLTGDFNSLPDSSPIEFLV- 263
            :.::.:.|||:..|....:.||:|.              ....|.||..|.||||||..:|:|. 
 Frog   356 MHWDPEYSDVKLIQTMMFVSELKSIIEKAASRPGSPTPDPNSIPFVLCADLNSLPDSGVVEYLTN 420

  Fly   264 -------------------------GKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWV----- 298
                                     ||||..|..          |..|....|.|:|..:     
 Frog   421 GGVADNHKDFKELRYNECLTNFSCNGKNGTPDGR----------ITHGFQLRSAYENNLMPYTNY 475

  Fly   299 ------IVDYILRS 306
                  ::|||..|
 Frog   476 TFDFKGVIDYIFYS 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 76/317 (24%)
cnot6lNP_001120421.1 leucine-rich repeat 33..52 CDD:275378
LRR_8 51..132 CDD:290566
LRR_4 51..91 CDD:289563
leucine-rich repeat 53..75 CDD:275378
leucine-rich repeat 76..90 CDD:275378
Deadenylase_CCR4b 186..521 CDD:197339 76/317 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84140068
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.