DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSP17.6A

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_196764.1 Gene:HSP17.6A / 831076 AraportID:AT5G12030 Length:156 Species:Arabidopsis thaliana


Alignment Length:98 Identity:27/98 - (27%)
Similarity:50/98 - (51%) Gaps:14/98 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DSEKFEVILDVQQFSPSEITVKVADKFV-IVEGKHEEKQDEHGYVS--------RQFSRRYQLPS 130
            |:..|.|  |:......||.|::.::.| :|.||.:....|:..|.        .:|.|::|||.
plant    55 DAYVFAV--DMPGIKGDEIQVQIENENVLVVSGKRQRDNKENEGVKFVRMERRMGKFMRKFQLPD 117

  Fly   131 DVNPDTVTSSLSSDGLLTIKAPMKALPPPQTER 163
            :.:.:.: |:..:||:|.:..|  .||||:.::
plant   118 NADLEKI-SAACNDGVLKVTIP--KLPPPEPKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 22/86 (26%)
HSP17.6ANP_196764.1 HSP20 49..137 CDD:365807 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.