DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and ODF1

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_077721.2 Gene:ODF1 / 4956 HGNCID:8113 Length:250 Species:Homo sapiens


Alignment Length:125 Identity:31/125 - (24%)
Similarity:51/125 - (40%) Gaps:33/125 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LRPWHTNSLQKQESGSTLNIDSEKFEVI----------------------LDVQQFSPSEITVKV 97
            |||    ||:..|..:...|:.||.|:.                      ::|..|.|.::.|:|
Human    83 LRP----SLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRV 143

  Fly    98 ADKFVIVEGKHEEKQDEHGYVSRQFS-----RRYQLPSDVNPDTVTSSLSSDGLLTIKAP 152
            .|..|.|..:.|.:.|..|  |:::|     :.:.||..|:...||.|......:.|::|
Human   144 KDGKVCVSAERENRYDCLG--SKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 25/109 (23%)
ODF1NP_077721.2 2 X 5 AA repeats of [RC]-C-L-C-D 34..77
ACD_HspB10 116..202 CDD:107237 21/88 (24%)
C-X-P repeat region 209..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.