DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)efl and cblb

DIOPT Version :9

Sequence 1:	NP_001261156.1	Gene:	l(2)efl / 37744	FlyBaseID:	FBgn0011296	Length:	187	Species:	Drosophila melanogaster
Sequence 2:	NP_001006802.1	Gene:	cblb / 448509	XenbaseID:	XB-GENE-1018102	Length:	982	Species:	Xenopus tropicalis

Alignment Length:	59	Identity:	13/59 - (22%)
Similarity:	26/59 - (44%)	Gaps:	2/59 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   103 IVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQT 161
            ::.|:|.....|.|::..:..:|.:.|  :....|.:.||.:....:...:...|||.|
Frog   633 VLNGRHSRMSTEAGFIRHKHHKRRESP--LETIRVYNGLSGNEEYDVPPRLSPPPPPPT 689

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)efl	NP_001261156.1	metazoan_ACD	71..153	CDD:107247	9/49 (18%)
cblb	NP_001006802.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..25
		4H	46..178
		Cbl_N	55..176	CDD:367006
		EF-hand-like	179..251
		Cbl_N2	182..265	CDD:367171
		SH2-like	252..354
		SH2_Cbl-b_TKB	259..353	CDD:198176
		Linker	355..383
		RING-HC_Cbl-b	365..430	CDD:319623
		RING-HC finger (C3HC4-type)	384..422	CDD:319623
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	480..582
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	709..728
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	766..911
		UBA_Cbl-b	931..971	CDD:270575
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3591
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900