DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSPB2

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001532.1 Gene:HSPB2 / 3316 HGNCID:5247 Length:182 Species:Homo sapiens


Alignment Length:166 Identity:56/166 - (33%)
Similarity:89/166 - (53%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESG-STLNIDSEKFEVILDV 85
            |||.:|.||:||..:::::      ||:....|:||....:.:...:| |.|.:...||:..|||
Human    22 SRLGEQRFGEGLLPEEILT------PTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDV 80

  Fly    86 QQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIK 150
            ..|:|.|:||:..|..:.|..:|.::.|.||:|||:|.|.|.||:||:|..|.::||.||:|.::
Human    81 SHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLE 145

  Fly   151 AP-----------------MKALPPPQTERLVQITQ 169
            ||                 :.|.|.|:.|....|.:
Human   146 APRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 36/98 (37%)
HSPB2NP_001532.1 Crystallin <21..51 CDD:425732 11/34 (32%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 35/80 (44%)

Return to query results.
Submit another query.