DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hsp-17

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001023957.1 Gene:hsp-17 / 186113 WormBaseID:WBGene00002021 Length:149 Species:Caenorhabditis elegans


Alignment Length:146 Identity:44/146 - (30%)
Similarity:74/146 - (50%) Gaps:37/146 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNS--LQKQESGST 71
            |.::|::||        |:|.                         :||:..:.  |.....|..
 Worm    16 RRFFDDVDF--------DRHM-------------------------IRPYWADQTMLTGHRVGDA 47

  Fly    72 LNI--DSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNP 134
            :::  :.:::.|.:||.||.|.|:.|.:.|..:|:||||.||.|::|.|.|.|.|:|.||:.|.|
 Worm    48 IDVVNNDQEYNVSVDVSQFEPEELKVNIVDNQLIIEGKHNEKTDKYGQVERHFVRKYNLPTGVRP 112

  Fly   135 DTVTSSLSSDGLLTIK 150
            :.:.|.||::|:||:|
 Worm   113 EQIKSELSNNGVLTVK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 34/82 (41%)
hsp-17NP_001023957.1 metazoan_ACD 49..128 CDD:107247 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.