DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Odf1

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_032783.2 Gene:Odf1 / 18285 MGIID:97424 Length:248 Species:Mus musculus


Alignment Length:75 Identity:21/75 - (28%)
Similarity:37/75 - (49%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFS-----RRYQLPSDVNPDTVTSSLS 142
            ::|..|.|.::.|:|.|..|.|..:.|.:.|..|  |:::|     :.:.||..|:...||.|..
Mouse   115 VNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLG--SKKYSYMNICKEFSLPPCVDEKDVTYSYG 177

  Fly   143 SDGLLTIKAP 152
            ....:.|::|
Mouse   178 LGSCVKIESP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 21/75 (28%)
Odf1NP_032783.2 2 X 5 AA repeats of [RC]-C-L-C-D 34..78
ACD_HspB10 102..188 CDD:107237 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.