Protein Alignment l(2)efl and Odf1

DIOPT Version :9

• Sequence 1: NP_001261156.1
• Gene: l(2)efl / 37744
• FlyBaseID: FBgn0011296
• Length: 187
• Species: Drosophila melanogaster
• Sequence 2: NP_032783.2
• Gene: Odf1 / 18285
• MGIID: 97424
• Length: 248
• Species: Mus musculus
• Alignment Length: 75
• Identity: 21/75 - (28%)
• Similarity: 37/75 - (49%)
• Gaps: 7/75 - (9%)

  Fly    83 LDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFS-----RRYQLPSDVNPDTVTSSLS 142
            ::|..|.|.::.|:|.|..|.|..:.|.:.|..|  |:::|     :.:.||..|:...||.|..
Mouse   115 VNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLG--SKKYSYMNICKEFSLPPCVDEKDVTYSYG 177

  Fly   143 SDGLLTIKAP 152
            ....:.|::|
Mouse   178 LGSCVKIESP 187

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
l(2)efl	NP_001261156.1	metazoan_ACD	71..153	CDD:107247	21/75 (28%)
Odf1	NP_032783.2	2 X 5 AA repeats of [RC]-C-L-C-D	34..78
		ACD_HspB10	102..188	CDD:107237	21/75 (28%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910