DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hsp-25

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:120 Identity:42/120 - (35%)
Similarity:68/120 - (56%) Gaps:14/120 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKF 101
            |||:    .|||.  ..||....:..::.:..|.||.:   :|    ||..:.|.|:|||..|..
 Worm   110 DLMA----HRPTY--DPYLDNLKSPLIKDESDGKTLRL---RF----DVANYKPEEVTVKTIDNR 161

  Fly   102 VIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKAL 156
            ::|..|||||..:. .|.|::::.:.||...||:.::|:||:||:||::||:..|
 Worm   162 LLVHAKHEEKTPQR-TVFREYNQEFLLPRGTNPEQISSTLSTDGVLTVEAPLPQL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 31/81 (38%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.