powered by:
Protein Alignment l(2)efl and LOC101732374
DIOPT Version :9
Sequence 1: | NP_001261156.1 |
Gene: | l(2)efl / 37744 |
FlyBaseID: | FBgn0011296 |
Length: | 187 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031754874.1 |
Gene: | LOC101732374 / 101732374 |
-ID: | - |
Length: | 755 |
Species: | Xenopus tropicalis |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 13/40 - (32%) |
Gaps: | 12/40 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 RYQLP----------SDV--NPDTVTSSLSSDGLLTIKAP 152
|.|.| ||: |....|.....:|.|..|.|
Frog 492 RTQFPKFTVIANIGRSDIYKNKKDYTEIYEPEGTLIFKCP 531
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165168124 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.