DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and LOC101732374

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_031754874.1 Gene:LOC101732374 / 101732374 -ID:- Length:755 Species:Xenopus tropicalis


Alignment Length:40 Identity:11/40 - (27%)
Similarity:13/40 - (32%) Gaps:12/40 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 RYQLP----------SDV--NPDTVTSSLSSDGLLTIKAP 152
            |.|.|          ||:  |....|.....:|.|..|.|
 Frog   492 RTQFPKFTVIANIGRSDIYKNKKDYTEIYEPEGTLIFKCP 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 11/40 (28%)
LOC101732374XP_031754874.1 sulP 59..706 CDD:273284 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165168124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.