DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and si:dkey-1k23.3

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:206 Identity:67/206 - (32%)
Similarity:112/206 - (54%) Gaps:40/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQG--LKRDDL--MSSVW-----NSRPTVLRSGYLR 56
            :|.:||..|  |..:.|        :||||..  |:..||  |..::     :|.|..:|||:|.
Zfish    13 VSWIPLSCR--WPSVIF--------NQHFGMPPLLEPRDLSWMEDIFRRLGTSSWPGYVRSGFLA 67

  Fly    57 PWHTNSLQ-----------KQESGSTLNIDSE--KFEVILDVQQFSPSEITVKVADKFVIVEGKH 108
            |    .||           ::.||....:.:|  ::::.|||..|:|:||:||:...|:.:.|||
Zfish    68 P----LLQASGPAVFSKPHRELSGGVSEVAAETCRWKISLDVNHFAPAEISVKIQHGFLEIAGKH 128

  Fly   109 EEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERL-VQI---TQ 169
            ||:||.||:::|.|:|:|.||..:..:.:.:|||:||:||::||..::|.|....: :|:   .|
Zfish   129 EERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSADGILTVEAPFPSIPLPADVIIPIQVESGAQ 193

  Fly   170 TGPSSKEDNAK 180
            |....::|..|
Zfish   194 TIAGKQQDGDK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 34/83 (41%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin-Hsps_p23-like 88..172 CDD:320797 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.