DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and TFIIIA

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_001322779.1 Gene:TFIIIA AraportID:AT1G72050 Length:427 Species:Arabidopsis thaliana

Alignment Length:370 Identity:74/371 (20%)
Similarity:126/371 (34%) Gaps:81/371 (22%)


  Fly   269 DDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLL--CEKSFFSKYDLAK 331
            :::||.....::.::....|.:|...|.....|:.|..:|:..|||.|.:  |..|:..|..|.:
plant    64 EERDDEACEVDEESSSNHTCQECGAEFKKPAHLKQHMQSHSLERSFTCYVDDCAASYRRKDHLNR 128

  Fly   332 HNFVHTGERPFKC--AICSKAFTRKALLHRH-ERTHT------------------------DVPK 369
            |...|.| :.|||  ..|...|:.:..:.|| ::.|:                        |..|
plant   129 HLLTHKG-KLFKCPKENCKSEFSVQGNVGRHVKKYHSNDNRDKDNTGLGDGDKDNTCKGDDDKEK 192

  Fly   370 FICVYCEKPFLSRQEMEKHAERHQKKRPFQCGV-----------CTKSFAFKQGLERHETVH--S 421
            .....|||.........|....:...:|.:|..           |.|:|.:...|::|:..|  .
plant   193 SGSGGCEKENEGNGGSGKDNNGNGDSQPAECSTGQKQVVCKEIGCGKAFKYPSQLQKHQDSHVKL 257

  Fly   422 TNLPFPCQH--CERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASF 484
            .::...|..  |.:.|:....|..|:  .:..:...|:.|...: |..::.||||||.:.|    
plant   258 DSVEAFCSEPGCMKYFTNEECLKSHI--RSCHQHINCEICGSKH-LKKNIKRHLRTHDEDS---- 315

  Fly   485 VCSECKVSYSNYNDLLDHALIHATASLKCPM--CRKQIEDIDSVESHMDQ-HKQSERHACEF--C 544
                                  :...:||.:  |........:::.||.. |.......|.|  |
plant   316 ----------------------SPGEIKCEVEGCSSTFSKASNLQKHMKAVHDDIRPFVCGFPGC 358

  Fly   545 DHIFLTQKCLQRHIEDD-HVVEMEPYQNEFED-DGEGEGGVDEKE 587
            ...|..:....:|.... ||.....:....|| .....||:..|:
plant   359 GMRFAYKHVRNKHENSGYHVYTCGDFVETDEDFTSRPRGGLKRKQ 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 54/269 (20%)
C2H2 Zn finger 288..308 CDD:275368 5/20 (25%)
C2H2 Zn finger 316..336 CDD:275368 6/22 (27%)
zf-H2C2_2 328..353 CDD:290200 9/27 (33%)
C2H2 Zn finger 344..364 CDD:275368 5/23 (22%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 6/31 (19%)
C2H2 Zn finger 428..448 CDD:275368 5/22 (23%)
C2H2 Zn finger 456..476 CDD:275368 8/20 (40%)
C2H2 Zn finger 486..506 CDD:275368 0/20 (0%)
HARE-HTH <566..625 CDD:294801 5/24 (21%)
TFIIIANP_001322779.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.