DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and TT1

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana

Alignment Length:329 Identity:71/330 (22%)
Similarity:111/330 (34%) Gaps:101/330 (31%)


  Fly   177 YELKVDNNQELSMDDVQSMLEDMASELEKEFPDIPQKA----SPVKPKVL----NKSSIRILNKG 233
            ||:...::.|......||:  |:       ||::.|.:    :.::|..|    |.:|...||..
plant     7 YEISSSSSSEKPRHHFQSL--DL-------FPNLNQNSCINNTLIEPLPLIDRINLNSNLDLNPN 62

  Fly   234 PAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDL---------PLDDQDDPTK-NAEKVAT-DV-- 285
            |....|......:.:.:|        ..:|.||         |.:|.....| |.:::|| |.  
plant    63 PLYAEEGEQEEEEEEEED--------REVDVDLHIGLPGFGKPSNDAKQLKKRNGKEIATYDAGK 119

  Fly   286 ------------FPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVH-- 336
                        .|.|        :|:|    :..|.   |.|.:|.|:|....:|..|.:.|  
plant   120 GIENELSGKAYWIPAP--------EQIL----IGFTH---FSCHVCFKTFNRYNNLQMHMWGHGS 169

  Fly   337 ---------TGERP-----FKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEK 387
                     .|.:|     ..|..|.:..          |.|.|.|:      .||....:.::.
plant   170 QYRKGPESLKGTQPRAMLGIPCYCCVEGC----------RNHIDHPR------SKPLKDFRTLQT 218

  Fly   388 HAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAH-AGK 451
            |.:|....:||.|.:|.|..|.|.....||  .:....:.|. |...|.....|..|:.|. :|.
plant   219 HYKRKHGHKPFSCRLCGKLLAVKGDWRTHE--KNCGKRWVCV-CGSDFKHKRSLKDHVKAFGSGH 280

  Fly   452 RAYP 455
            ..||
plant   281 GPYP 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 46/208 (22%)
C2H2 Zn finger 288..308 CDD:275368 3/20 (15%)
C2H2 Zn finger 316..336 CDD:275368 6/20 (30%)
zf-H2C2_2 328..353 CDD:290200 7/41 (17%)
C2H2 Zn finger 344..364 CDD:275368 3/20 (15%)
C2H2 Zn finger 372..388 CDD:275370 2/16 (13%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..448 CDD:275368 6/20 (30%)
C2H2 Zn finger 456..476 CDD:275368 71/330 (22%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 5/16 (31%)
C2H2 Zn finger 257..274 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.