DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and AT3G29340

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana

Alignment Length:454 Identity:103/455 (23%)
Similarity:150/455 (33%) Gaps:151/455 (33%)


  Fly   343 KCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQK--KRP------FQ 399
            ||.||.|:|.....|..|:|.|..:         |..||:||..:...|..|  |||      ::
plant    44 KCKICGKSFECYQALGGHQRIHRPI---------KEKLSKQEFSEVYPRKSKLQKRPESSSSCYE 99

  Fly   400 CGVCTKSFAFKQGLERHETVH-STNLPFPCQHCERSF---STASKLAR--------------HLV 446
            |.||.|.|...:||..|..:| ||.........|.|.   |.|.|:..              |.|
plant   100 CKVCGKIFGCYRGLGGHTKLHRSTKRELASTQDENSLLDSSEAKKIVSQPSSFKVSQEEKFLHCV 164

  Fly   447 ----------AHAG----------------KRAYPCKYCHKSYMLSHHLSRHLRTHTQTS----- 480
                      :|:|                |.:..||.|.||::.|..|..|.|.|.:.|     
plant   165 ELKQDFSEPLSHSGALPSTLRSKLQTKTQWKSSCHCKICGKSFVCSQGLGNHKRVHREISGKLAC 229

  Fly   481 -----------------------DASFVCSE------CKVSYSNYNDLLDHA----LIHATASLK 512
                                   .:||..|:      |.....::.:||.|:    .|..:.|:|
plant   230 KRKYTEDYNPFSDSLKAKKIVKKPSSFEVSQEEKILHCVELKQDFGELLAHSGFDKSISCSKSIK 294

  Fly   513 C-PMCRK--QIEDIDSVESHMDQHKQSERHACEFCDHIFLTQKCL---QRHIEDDHVVEMEPYQN 571
            . .:.||  :.||..|:............|.|:.|...|.|.|.:   ||....:|        |
plant   295 VKKVARKNEKTEDSTSLFGVFVGEMSQRLHGCKTCGRKFGTLKGVYGHQRMHSGNH--------N 351

  Fly   572 EFEDDGEGEGGVD-----EKEEHLDDFEDMDNVKQEEFVTEYLEDDALYEDHL----------DD 621
            ..||    |.|::     :|:..:......|..|...|:.| :|...:.|..|          |.
plant   352 RIED----ENGLERIWGLKKKSRVCSVSAFDRFKGSSFMAE-IEKHEVIEAALNLVMLCQGVYDF 411

  Fly   622 SDESFTP-----------PPPKQRKTNPPKDAQQSVRQTRSRDAQRITQKTGKNEGKPHHKLER 674
            :..|..|           |.|.:||..  |.::.|.:.:....:...:|..|.     |.:|.|
plant   412 ASISNLPLGDGFMDLELKPCPLRRKLQ--KKSRSSYKCSICEKSFVCSQALGS-----HQRLHR 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 60/253 (24%)
C2H2 Zn finger 288..308 CDD:275368
C2H2 Zn finger 316..336 CDD:275368
zf-H2C2_2 328..353 CDD:290200 6/10 (60%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
C2H2 Zn finger 372..388 CDD:275370 5/16 (31%)
C2H2 Zn finger 400..420 CDD:275368 8/20 (40%)
C2H2 Zn finger 428..448 CDD:275368 7/47 (15%)
C2H2 Zn finger 456..476 CDD:275368 9/20 (45%)
C2H2 Zn finger 486..506 CDD:275368 6/30 (20%)
HARE-HTH <566..625 CDD:294801 14/74 (19%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 10/24 (42%)
C2H2 Zn finger 45..65 CDD:275368 8/20 (40%)
C2H2 Zn finger 100..120 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24390
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.