DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG18764

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster

Alignment Length:497 Identity:114/498 (23%)
Similarity:183/498 (37%) Gaps:111/498 (22%)


  Fly    11 MLTEKRVCRFCLTEQKLASIFE-ENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFE 74
            |..:.|.|...:..:...::|. ||.::....||      :|...::....:|..||..|.|...
  Fly     1 MALQCRTCGSIIYNKMPKNLFHIENEKMLQDINL------VTGTTLHNDPELPSSICACCTLDLN 59

  Fly    75 HCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTM 139
            ....|::.|     :|.|..|.....||..|.               ||:..|...:|...||..
  Fly    60 QAILFRERC-----ILTQKQLVHRRRSPEAKE---------------PAEDVEEMASPPDCLNDP 104

  Fly   140 AKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSM--LEDMASE 202
            .....:.|:|                  ||.....|..:...|.:::..:|.|:.:  |:|||..
  Fly   105 FGEVDEYIVE------------------SPEEVLDHDSDAHHDLDEDNYIDSVEDVDALQDMAEV 151

  Fly   203 LEKEFPDIPQKASPVKPK---VLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDS 264
            .|::..|:....|.|:.:   :.|..|    |......:||:            |.:...|.::.
  Fly   152 AEEDSQDVESLISSVQKELESICNDDS----NSDNNDYMEPQ------------NGSYFNETINE 200

  Fly   265 -------DLPLDDQDDPTKNAEKVATDVFPCPDCERSFPL------QQLLEIHRLNHTRSRSFQC 316
                   :.||.:.......:.|.||..   |..::.:..      :|::|..||.  |.|...|
  Fly   201 YEVSSNPNTPLPESKSAAGRSTKPATTK---PKRKKQYVTWKNMTEEQIIERKRLQ--RKRECVC 260

  Fly   317 LLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLS 381
            ..|.:.|..:.:...|...|||.:.|.|..|.|.|....|:..|:|.                  
  Fly   261 EQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRI------------------ 307

  Fly   382 RQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLV 446
                     .||.::|:.|..|||||........||..|:...|:.|.||::.|.:||...||.:
  Fly   308 ---------IHQGEKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHEL 363

  Fly   447 AHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSE 488
            .|.|.||:.|..|.:|:..:.||..|||:...|:.|..:.:|
  Fly   364 IHTGVRAFACTICKQSFQRNTHLKAHLRSKFHTAKAKTIGAE 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 15/76 (20%)
COG5048 <281..506 CDD:227381 60/215 (28%)
C2H2 Zn finger 288..308 CDD:275368 5/26 (19%)
C2H2 Zn finger 316..336 CDD:275368 4/20 (20%)
zf-H2C2_2 328..353 CDD:290200 9/25 (36%)
C2H2 Zn finger 344..364 CDD:275368 7/20 (35%)
C2H2 Zn finger 372..388 CDD:275370 0/16 (0%)
C2H2 Zn finger 400..420 CDD:275368 8/20 (40%)
C2H2 Zn finger 428..448 CDD:275368 8/20 (40%)
C2H2 Zn finger 456..476 CDD:275368 8/20 (40%)
C2H2 Zn finger 486..506 CDD:275368 1/4 (25%)
HARE-HTH <566..625 CDD:294801
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 17/82 (21%)
C2H2 Zn finger 260..280 CDD:275368 4/20 (20%)
zf-H2C2_2 272..297 CDD:290200 9/25 (36%)
C2H2 Zn finger 288..309 CDD:275368 7/48 (15%)
C2H2 Zn finger 317..337 CDD:275368 8/20 (40%)
C2H2 Zn finger 345..365 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..391 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.