DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and Rbak

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:XP_006504786.1 Gene:Rbak MGIID:1927369 Length:846 Species:Mus musculus

Alignment Length:446 Identity:116/447 (26%)
Similarity:173/447 (39%) Gaps:73/447 (16%)


  Fly   149 EDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLE--DMASELEKEF---- 207
            ::...||:|:::|.:.|.|......:      :::..||...|....||  .|..|..|.:    
Mouse   252 DEAYTLETALISPSSGAHSCVSCGET------LESVSELISSDGSYALEKPSMCFECGKAYGESL 310

  Fly   208 PDIPQ---KASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTE-VLDSDLPL 268
            .|..|   .:|.....:|.|.:|          :|...|...::..||.:|.:..| ....:.|.
Mouse   311 EDFNQDEGNSSQHDENILQKVTI----------LEKPFAYECMEALDSESVFMARERAYMGEKPY 365

  Fly   269 DDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHN 333
            |..|.        ..|.....|.. ::|..|:         ..:.|:|..|.|||..|.....|.
Mouse   366 DWGDS--------GPDFIQMSDFS-TYPRSQM---------ELKPFECTQCGKSFCKKSKFIIHQ 412

  Fly   334 FVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPF 398
            ..||||:|:.|::|.|:|::|..|..|.|:|.:...:.|..|.|.|..:..:.:|...|..::|:
Mouse   413 RAHTGEKPYACSVCGKSFSQKGTLTVHRRSHLEEKPYKCNECGKTFCQKLHLTQHQRTHSGEKPY 477

  Fly   399 QCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSY 463
            :|..|.|||..|..|..|:..||...|:||..|.:|||..|.|..|...|.|::.|.|..|.|||
Mouse   478 ECSECGKSFCQKTHLTLHQRNHSGERPYPCNECGKSFSRKSALNDHQRTHTGEKLYKCNECGKSY 542

  Fly   464 MLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIHATAS-LKCPMCRKQIEDIDSVE 527
            .....|..|.|||  |.:..:.||||...:|..:.|..|...|.... .:|..|.|......:..
Mouse   543 YRKSTLITHQRTH--TGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYECTECGKTFNLNSAFI 605

  Fly   528 SHMDQHKQ--------------------------SERHACEFCDHIFLTQKCLQRH 557
            .|...|.:                          .:|:.|..|...||......||
Mouse   606 RHWKVHAEERVQECGECGKPSPLQCAPDHTGDLGEKRYECNECGKTFLDSSAFHRH 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 74/225 (33%)
C2H2 Zn finger 288..308 CDD:275368 3/20 (15%)
C2H2 Zn finger 316..336 CDD:275368 7/20 (35%)
zf-H2C2_2 328..353 CDD:290200 10/25 (40%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 8/20 (40%)
C2H2 Zn finger 428..448 CDD:275368 8/20 (40%)
C2H2 Zn finger 456..476 CDD:275368 9/20 (45%)
C2H2 Zn finger 486..506 CDD:275368 7/20 (35%)
HARE-HTH <566..625 CDD:294801
RbakXP_006504786.1 KRAB 143..203 CDD:214630
KRAB 143..182 CDD:279668
Extradiol_Dioxygenase_3B_like <252..>349 CDD:294399 24/113 (21%)
COG5048 386..829 CDD:227381 84/288 (29%)
C2H2 Zn finger 395..415 CDD:275368 7/20 (35%)
zf-H2C2_2 411..432 CDD:290200 10/21 (48%)
C2H2 Zn finger 423..443 CDD:275368 8/20 (40%)
zf-H2C2_2 436..458 CDD:290200 7/22 (32%)
zf-C2H2 449..471 CDD:278523 5/22 (23%)
C2H2 Zn finger 451..471 CDD:275368 5/20 (25%)
zf-H2C2_2 463..486 CDD:290200 7/23 (30%)
C2H2 Zn finger 479..499 CDD:275368 8/20 (40%)
zf-H2C2_2 491..516 CDD:290200 11/25 (44%)
C2H2 Zn finger 507..527 CDD:275368 8/20 (40%)
zf-H2C2_2 519..544 CDD:290200 10/25 (40%)
zf-C2H2 533..555 CDD:278523 10/22 (45%)
C2H2 Zn finger 535..555 CDD:275368 9/20 (45%)
zf-H2C2_2 548..572 CDD:290200 11/26 (42%)
C2H2 Zn finger 563..583 CDD:275368 7/20 (35%)
zf-H2C2_2 575..599 CDD:290200 6/24 (25%)
C2H2 Zn finger 591..611 CDD:275368 4/20 (20%)
C2H2 Zn finger 645..665 CDD:275368 6/18 (33%)
C2H2 Zn finger 673..693 CDD:275368
C2H2 Zn finger 701..721 CDD:275368
zf-C2H2 701..721 CDD:278523
zf-H2C2_2 713..738 CDD:290200
C2H2 Zn finger 729..749 CDD:275368
zf-H2C2_2 741..766 CDD:290200
C2H2 Zn finger 757..777 CDD:275368
zf-H2C2_2 769..794 CDD:290200
C2H2 Zn finger 785..805 CDD:275368
zf-H2C2_2 797..822 CDD:290200
C2H2 Zn finger 813..833 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.