DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and sens

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_524818.1 Gene:sens FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster

Alignment Length:506 Identity:104/507 (21%)
Similarity:169/507 (33%) Gaps:172/507 (34%)


  Fly    47 IMAITAIEVYAGDGMPGHICLECRLLFEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMT 111
            ::|..|.:...|..:|   .|...||:.....:.|....:.|.|.. |||     |: .|::|.:
  Fly    41 VIASAAAQKLNGRDLP---FLYNPLLYSSALLWPQFLLSSATALGT-PLT-----PM-TPKSPAS 95

  Fly   112 MVASKK---LLVVPAKTAE-----------------PSETPKKL-------------------LN 137
            :|..::   ..:.|.|..|                 ..:.|..|                   .|
  Fly    96 VVLGQRDRDFALTPEKEHELQMNNNNENSKQDYQEQDEDMPLNLSTKERITSDDSNRDQYHSSSN 160

  Fly   138 TMAKSSSQVIIEDVQVLESAMVTPRTVAG----SSPVPR----------------------RSHA 176
            ..::|||...:|.:..:.|..|||..::.    ||..|:                      |...
  Fly   161 NSSRSSSSSEVEQLHPMTSLNVTPPPLSAVNLKSSSTPQQQRQRSQGNIIWSPASMCERSARREQ 225

  Fly   177 YELKVDNNQELSMDDVQSMLEDMASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPR 241
            |.||::...:.....|..::...  :.|:....|....||:       ||:..........:|..
  Fly   226 YGLKMEEQGDEEEHQVDPIVRKF--KYERRTASISSLQSPI-------SSLSAPASNAVQDLEFE 281

  Fly   242 LATPKVKRDDSGNVAIVT----EVLDSDLPL---------------DDQDDPTKNA--------- 278
            :|..::....|..:|.:|    |:|...|.|               |:|....::|         
  Fly   282 VAQQQLYAHRSAFMAGLTGNNLELLTQHLKLKSEQPQQQQQQHRIKDEQQQDNRSAAALMNLVAA 346

  Fly   279 -------------------------------------EKVATDV--------------------- 285
                                                 :..||||                     
  Fly   347 AEFGYMRNQHQQPQQQQQQQLHHQQQPQQHQHQQQHPDSTATDVARRSSSSSSYQGENEEKRSGR 411

  Fly   286 -FPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSK 349
             |.|..|.:||.....|..|.|.|:.:|.:.|..|.|.|..|.|:.||.::||||:|.||.:|.|
  Fly   412 NFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCLK 476

  Fly   350 AFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAE-RHQKKRPFQ 399
            ||::.:.|..|.|.||....|.|..|::.|..:.::.:|.| ||::..|.:
  Fly   477 AFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRHEEAPPVE 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 10/45 (22%)
COG5048 <281..506 CDD:227381 47/143 (33%)
C2H2 Zn finger 288..308 CDD:275368 7/20 (35%)
C2H2 Zn finger 316..336 CDD:275368 8/20 (40%)
zf-H2C2_2 328..353 CDD:290200 14/25 (56%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
C2H2 Zn finger 372..388 CDD:275370 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 104/507 (21%)
C2H2 Zn finger 428..448 CDD:275368
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 8/22 (36%)
C2H2 Zn finger 415..435 CDD:275368 7/20 (35%)
COG5048 423..>497 CDD:227381 29/74 (39%)
zf-H2C2_2 428..452 CDD:290200 9/24 (38%)
C2H2 Zn finger 443..463 CDD:275368 8/20 (40%)
zf-H2C2_2 455..480 CDD:290200 14/25 (56%)
C2H2 Zn finger 471..491 CDD:275368 8/20 (40%)
C2H2 Zn finger 499..516 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.