DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG1792

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster

Alignment Length:518 Identity:108/519 (21%)
Similarity:176/519 (34%) Gaps:172/519 (33%)


  Fly    16 RVCR------FCLTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDG--MPGHICLECRLL 72
            |.||      ||.|.   :::|||...|     :..||..:|.:.:..|.|  :|..||..|.|.
  Fly     4 RNCRTCGLFIFCSTP---SNLFEEPNSV-----MLHQIEVLTGLFLLGGPGNELPPFICSPCELD 60

  Fly    73 FEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLN 137
            .:....|::...|.:..|::.|..||                                       
  Fly    61 LQTAIAFRERVIRTQKTLQESPNLGN--------------------------------------- 86

  Fly   138 TMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSML--EDMA 200
                         .:::||..|                ..|.::...:|::..:|..:|  |.:.
  Fly    87 -------------AELIESFAV----------------GVEKEIQYAEEVTEIEVIDLLPEEHLL 122

  Fly   201 SELEKEFP-----DIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTE 260
            .|.|:.:.     :.||...|.:.|.|.:|:               ..||.|             
  Fly   123 EETEEPYEICEQNEQPQVKVPAQEKKLRRST---------------KTTPTV------------- 159

  Fly   261 VLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFS 325
              .:.:...|....|:......|:             .:::.:.|  ..|.|...|..|.:.|..
  Fly   160 --FTSVKFADNSQATRTQWSRLTE-------------DEVVALKR--ERRKRDCICEQCGRHFTC 207

  Fly   326 KYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAE 390
            ..:...|...|||.:.|.|..||:.|....||.||:..|.....|.|.|||              
  Fly   208 PSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCE-------------- 258

  Fly   391 RHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNL-PFPCQHCERSFSTASKLARHLVAHAGKRAY 454
                          .:::...|..:||.:..||: ||.|:.|.:||:.:.||..|:::|.|.||:
  Fly   259 --------------ATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAF 309

  Fly   455 PCKYCHKSYMLSHHLSRHLRT----HTQTSDASF---VCSECKVSYSNYNDLLDHALIHATAS 510
            .|..|..|::...||:.|.|:    ||.::.|:.   |..:.|.|........|.||:..:.|
  Fly   310 HCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELDVKASNGMQTGAKDEALLGKSGS 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 22/83 (27%)
COG5048 <281..506 CDD:227381 60/233 (26%)
C2H2 Zn finger 288..308 CDD:275368 1/20 (5%)
C2H2 Zn finger 316..336 CDD:275368 4/20 (20%)
zf-H2C2_2 328..353 CDD:290200 9/25 (36%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 3/20 (15%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 7/24 (29%)
C2H2 Zn finger 486..506 CDD:275368 5/20 (25%)
HARE-HTH <566..625 CDD:294801
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 22/82 (27%)
C2H2 Zn finger 198..218 CDD:275368 4/20 (20%)
C2H2 Zn finger 226..243 CDD:275368 8/17 (47%)
C2H2 Zn finger 254..275 CDD:275368 7/49 (14%)
zf-C2H2 281..303 CDD:278523 8/22 (36%)
C2H2 Zn finger 283..303 CDD:275368 7/20 (35%)
zf-H2C2_2 296..320 CDD:290200 9/24 (38%)
C2H2 Zn finger 311..329 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.