DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG11902

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_651389.3 Gene:CG11902 FlyBaseID:FBgn0028647 Length:1426 Species:Drosophila melanogaster

Alignment Length:648 Identity:131/649 (20%)
Similarity:210/649 (32%) Gaps:226/649 (35%)


  Fly   126 AEPSETPK-------KLLNTMAKSS-SQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVD 182
            ||..:.|.       .|.||:.|.. :::|:.|||   ......|.:         |...|..::
  Fly   789 AEDRDIPSASKAFYPDLENTLEKDELAEMIMADVQ---REFDLDRFI---------SITNEAGLE 841

  Fly   183 NNQELSMDDVQSMLEDMASEL-----------------------EKEFPDIPQKASPVKPKVLNK 224
            .|.|.|..|.:|..||..|.|                       |.::.:.....|..:.:.:|:
  Fly   842 LNLESSETDTESEQEDNHSSLNYPCNLCTTVVKRKHQLYAHQLEEHKWEEAVLVCSNCQTRFVNE 906

  Fly   225 SSI----RILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKNAEKVATDV 285
            |.:    |.|...|....:.|....:.:..:  |:.:..||......|..|||    ..||..|:
  Fly   907 SLLDHHSRTLCHNPQKLFQCRKCPLRFRWRE--NLKLHMEVFHMLDELSIQDD----LPKVDGDL 965

  Fly   286 FPCPDCERSFPLQQLLEIHRLNH-TRSRSFQCLLCEKSFFSKYDLAKH----------------- 332
             .|..|.|||.:|:.|..|.|.| ..|..|:|..|.:.|:.:.:|.:|                 
  Fly   966 -QCGKCNRSFRMQKDLTRHTLMHGQESNIFRCRWCARRFYRRANLLQHIARHGISVSQLPYAEAI 1029

  Fly   333 --NFVHTGER-PFKCAICSKAFTRKALLHRH---------------------------------- 360
              ::|:.|.| ..:|.:|:.:|...|.|..|                                  
  Fly  1030 LDSYVNPGGRKKVECRVCNVSFPTIAALRLHLETMPAGSHHDYSSLQNYSITNQMGFEMDLYDSE 1094

  Fly   361 -----ERTHTDVP----KFICVYCEKPFLSRQEMEKHAE-------------------------R 391
                 .|||...|    .:.|..|:...|.:.|:.:|.:                         .
  Fly  1095 TDDEDSRTHIKPPGAPSSYTCNMCQLRCLRKFELYQHQQAMHRMEKISDGCDSCLFKSVCPEIIS 1159

  Fly   392 HQKK--------------------------------------------------------RPFQC 400
            |.|:                                                        :.|||
  Fly  1160 HHKRTQCENREKQFKCTRCGYKFMWESNLLLHMDLQHVKTEDQELDESKEASGDEPKTEGQVFQC 1224

  Fly   401 GVCTKSFAFKQGLERH-----------ETVHSTNLP--------FPCQHCERSFSTASKLARHLV 446
            |:||:.:..|..|..|           .|..:.|.|        |.|..|.::.|::|.|..|:.
  Fly  1225 GLCTRKYNRKDRLTAHLKKFHGPDCKPSTAKTPNRPISPKEPKRFLCAFCGKAVSSSSNLIIHMR 1289

  Fly   447 AHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIHA-TAS 510
            .|.|::.:.|:||..::..|..|..|.|||  |.:...||:.|:..::....|..|..||: ...
  Fly  1290 RHTGEKPFKCEYCTMAFPRSSDLQCHRRTH--TGERPHVCTVCQKGFARSYKLQQHMRIHSGERP 1352

  Fly   511 LKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCDHIFLTQKCLQRH-IEDDHVVE----MEP 568
            .||..|.|.....:.:..|:.:|.....:.|..|...|:....|:.| ::..|..|    :||
  Fly  1353 YKCTYCEKSFTQSNDLTLHIRRHTGERPYQCGVCGERFIQGTALKNHRMQQSHYEEGQESVEP 1415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 76/389 (20%)
C2H2 Zn finger 288..308 CDD:275368 9/20 (45%)
C2H2 Zn finger 316..336 CDD:275368 6/39 (15%)
zf-H2C2_2 328..353 CDD:290200 8/45 (18%)
C2H2 Zn finger 344..364 CDD:275368 8/59 (14%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 8/31 (26%)
C2H2 Zn finger 428..448 CDD:275368 6/20 (30%)
C2H2 Zn finger 456..476 CDD:275368 8/20 (40%)
C2H2 Zn finger 486..506 CDD:275368 5/20 (25%)
HARE-HTH <566..625 CDD:294801 2/4 (50%)
CG11902NP_651389.3 zf-AD 6..83 CDD:285071
C2H2 Zn finger 208..228 CDD:275368
C2H2 Zn finger 236..256 CDD:275368
C2H2 Zn finger 384..405 CDD:275368
C2H2 Zn finger 417..437 CDD:275368
C2H2 Zn finger 447..463 CDD:275368
C2H2 Zn finger 578..599 CDD:275368
C2H2 Zn finger 610..629 CDD:275368
C2H2 Zn finger 640..660 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 706..726 CDD:275368
C2H2 Zn finger 762..782 CDD:275368
C2H2 Zn finger 866..887 CDD:275368 1/21 (5%)
C2H2 Zn finger 896..918 CDD:275368 5/22 (23%)
C2H2 Zn finger 926..947 CDD:275368 4/23 (17%)
C2H2 Zn finger 967..987 CDD:275368 9/20 (45%)
C2H2 Zn finger 996..1016 CDD:275368 5/20 (25%)
C2H2 Zn finger 1044..1063 CDD:275368 6/19 (32%)
C2H2 Zn finger 1224..1244 CDD:275368 7/20 (35%)
C2H2 Zn finger 1271..1291 CDD:275368 6/20 (30%)
zf-H2C2_2 1283..1306 CDD:290200 7/23 (30%)
COG5048 1295..>1367 CDD:227381 21/74 (28%)
C2H2 Zn finger 1299..1319 CDD:275368 8/20 (40%)
zf-H2C2_2 1311..1336 CDD:290200 9/27 (33%)
C2H2 Zn finger 1327..1347 CDD:275368 5/20 (25%)
zf-H2C2_2 1340..1364 CDD:290200 8/24 (33%)
C2H2 Zn finger 1355..1375 CDD:275368 4/20 (20%)
zf-H2C2_2 1367..1392 CDD:290200 5/25 (20%)
C2H2 Zn finger 1383..1401 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.