DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG4854

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster

Alignment Length:468 Identity:89/469 (19%)
Similarity:157/469 (33%) Gaps:166/469 (35%)


  Fly    18 CRFCLTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFKQM 82
            ||.||.:.|..|:....|      :.|.:|...|.:|:......|..||..|.||.....:.:.:
  Fly    12 CRICLVQPKDESLMPTEP------DFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLRSL 70

  Fly    83 CKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTMAKSSSQVI 147
            |::.|..|::                       :||..:..:.....:..||...:...|.::..
  Fly    71 CQQTEKDLKE-----------------------QKLQEINIEIVHDEQETKKKTESRDLSKNEAT 112

  Fly   148 IEDVQV----LESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMASELEKEFP 208
            ..|.::    |:|                    |::.::     |.:||....:::.|       
  Fly   113 GSDSELEYEYLDS--------------------YDVTLE-----SSEDVACSADELVS------- 145

  Fly   209 DIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDD 273
                                         :||.::.|:..         |..:....:..:|:|.
  Fly   146 -----------------------------IEPAISAPEES---------VYSLSPKPVTFEDEDS 172

  Fly   274 PTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTG 338
                                               .::.||.|.:|...:..:..|..|..||:.
  Fly   173 -----------------------------------GQAASFTCNICNNVYSERVKLTNHMKVHSA 202

  Fly   339 ERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVC 403
            ::|.:|.||.|.|.:...|.||..|||.                            .||::|..|
  Fly   203 KKPHECEICHKRFRQTPQLARHMNTHTG----------------------------NRPYKCDYC 239

  Fly   404 TKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHH 468
            ...||......:|:.:|:...|:.|:.|.|||..::.|..||..|.|:|.:.|:||.||:...||
  Fly   240 DSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHH 304

  Fly   469 LSRHLRTHTQTSD 481
            .:.|.::|.:|.:
  Fly   305 KNSHEKSHKRTKE 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 20/74 (27%)
COG5048 <281..506 CDD:227381 50/202 (25%)
C2H2 Zn finger 288..308 CDD:275368 0/20 (0%)
C2H2 Zn finger 316..336 CDD:275368 5/20 (25%)
zf-H2C2_2 328..353 CDD:290200 10/25 (40%)
C2H2 Zn finger 344..364 CDD:275368 9/20 (45%)
C2H2 Zn finger 372..388 CDD:275370 0/16 (0%)
C2H2 Zn finger 400..420 CDD:275368 5/20 (25%)
C2H2 Zn finger 428..448 CDD:275368 8/20 (40%)
C2H2 Zn finger 456..476 CDD:275368 8/20 (40%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 14/51 (27%)
C2H2 Zn finger 180..200 CDD:275368 5/20 (25%)
zf-H2C2_2 193..217 CDD:290200 10/24 (42%)
COG5048 201..>258 CDD:227381 20/85 (24%)
C2H2 Zn finger 208..228 CDD:275368 9/20 (45%)
zf-H2C2_2 221..244 CDD:290200 11/51 (22%)
C2H2 Zn finger 236..256 CDD:275368 5/20 (25%)
zf-H2C2_2 251..273 CDD:290200 8/22 (36%)
C2H2 Zn finger 264..284 CDD:275368 8/20 (40%)
zf-H2C2_2 277..301 CDD:290200 11/24 (46%)
C2H2 Zn finger 292..312 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.