DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and Odj

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster

Alignment Length:641 Identity:133/642 (21%)
Similarity:207/642 (32%) Gaps:235/642 (37%)


  Fly    11 MLTEKRVCRFCLTEQKLASIFEE-NPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFE 74
            |.||.|:|...:......:|||: |.|::      :.|..||.:|:...:.:|.|||..|.|...
  Fly     1 MSTECRICGERIFTPHPKNIFEKRNHRIR------MAIEQITGLEIVLENMLPQHICACCLLDLT 59

  Fly    75 HCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTM 139
            ....|:|.|......|.|                   .::||..:   |....|..:| .|.:.:
  Fly    60 QAVAFRQRCLETHANLHQ-------------------RISSKAGV---ASKGSPEVSP-VLSDPL 101

  Fly   140 AKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLED------ 198
            .|.         :||:..:.|             ....|| :|::::| |||.:..|||      
  Fly   102 LKR---------EVLDDTVDT-------------EDDKEL-LDDDKDL-MDDDKDFLEDEKPILR 142

  Fly   199 --MASELEKEFPDIPQKASP-VKPKVLNKSSIRILNKGPAAPVE----PRLATPKVKRDDSGNVA 256
              .|.::..|..:.|.:.|| |:.|.|....:...:..|..|.|    ||...||.|.|.|    
  Fly   143 YPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPPPREHVRKPRKRRPKPKVDRS---- 203

  Fly   257 IVTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEK 321
                                      ...:.|..|..||.....::.|:|.|...: |.|..|.:
  Fly   204 --------------------------IKRYVCDQCGWSFNDHSNMKDHKLRHFEEK-FSCDECGR 241

  Fly   322 SFFSKYDLAKHNFV-HTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEM 385
            .|::...|..|..| |.||:|:.|..|...|.......||||                       
  Fly   242 KFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHER----------------------- 283

  Fly   386 EKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLP--FPCQHCERSFSTASKLARHLVAH 448
                :.|..:....|.:|.|.|..::|..:||..|.::.|  ..|..|.:.|..|..|.||    
  Fly   284 ----QMHANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRH---- 340

  Fly   449 AGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIHATASLKC 513
                 |..||         |..|                                          
  Fly   341 -----YSTKY---------HRKR------------------------------------------ 349

  Fly   514 PMCRKQIEDIDSVESHMDQHKQSERHACEFCDHIFLTQKCLQRHIEDDHVVEMEPYQNEFEDDGE 578
                     ::.:.:...:..|||....||..:                   ||          |
  Fly   350 ---------VNLLVNGPKEEFQSEVDPAEFPGY-------------------ME----------E 376

  Fly   579 GEGGVDEKEEHLDDFEDMDNVKQEEFVT-EYLED------DALYEDHLDDSDESFT 627
            |:..:::.:..||..  :||:.:|::.. |.|:|      |..||:.:.|.:|.:|
  Fly   377 GQAEMEDNQAELDVM--LDNIDEEQYEDHEVLQDEDANFEDFEYEEAIPDGEELYT 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 20/76 (26%)
COG5048 <281..506 CDD:227381 47/228 (21%)
C2H2 Zn finger 288..308 CDD:275368 6/20 (30%)
C2H2 Zn finger 316..336 CDD:275368 6/21 (29%)
zf-H2C2_2 328..353 CDD:290200 10/26 (38%)
C2H2 Zn finger 344..364 CDD:275368 7/20 (35%)
C2H2 Zn finger 372..388 CDD:275370 0/16 (0%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 4/20 (20%)
C2H2 Zn finger 486..506 CDD:275368 0/20 (0%)
HARE-HTH <566..625 CDD:294801 17/66 (26%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 21/78 (27%)
COG5048 <202..343 CDD:227381 44/208 (21%)
C2H2 Zn finger 209..229 CDD:275368 6/20 (30%)
C2H2 Zn finger 236..256 CDD:275368 6/20 (30%)
zf-H2C2_2 249..274 CDD:290200 10/25 (40%)
C2H2 Zn finger 265..283 CDD:275368 6/18 (33%)
C2H2 Zn finger 298..314 CDD:275368 5/16 (31%)
zf-C2H2_jaz 322..347 CDD:288983 11/43 (26%)
C2H2 Zn finger 324..343 CDD:275368 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.