DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG17802

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_650659.2 Gene:CG17802 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster

Alignment Length:463 Identity:101/464 (22%)
Similarity:164/464 (35%) Gaps:116/464 (25%)


  Fly    18 CRFC---LTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRF 79
            ||.|   :..|...:||:||      :.:..||..:|.:.:.....||.::|..|.|..:....|
  Fly     5 CRLCGDLIYTQNPVNIFDEN------SKMVRQIALVTGLWLTDHSKMPRNMCSCCLLSLKSAIAF 63

  Fly    80 KQMCKRAETLLR------QYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNT 138
            :|.|.:....|.      :....|.|..||......:.:              ..:|..:::|..
  Fly    64 RQACIKTNNRLTIQRRSVEAKDDGCWADPLSDAHEGLKI--------------NDAEVEQEVLYE 114

  Fly   139 MAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQEL----------SMDDVQ 193
            ::.:.::.:.||..:.                  :....|.:|:.|:|.          ..||.|
  Fly   115 VSYADNEGLEEDHDLY------------------KKEEEESEVNENKEFEDIACEIPFSKEDDEQ 161

  Fly   194 SM---LEDM------------ASELEKEFPDIPQKASPVKPKVLNK------------------- 224
            ..   .|||            :.|.|:..||..:.....:.:..::                   
  Fly   162 EQQQEYEDMVDKKTGHDDGEESQECEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDAD 226

  Fly   225 --SSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQD--DPTKNAEK--VAT 283
              |.|...::..|...:.:......||....|              ||.|  .|.|...|  ::.
  Fly   227 SMSDIEATSRQSALDEDKKPRRKYTKRSSPKN--------------DDTDFLKPAKKKRKTYISQ 277

  Fly   284 DVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFV-HTGERPFKCAIC 347
            .|..|..|.:.|..:....:|.|.|:..:.|:|..|.:..|::|.|..|..| |.||:|:.|..|
  Fly   278 KVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFC 342

  Fly   348 SKAFTRKALLHRHE-RTHTD--VPK-FICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFA 408
            .:.|....:..||| |.|.:  .|| |.|.||:|.:.|..:..||...|..:|.|.|.||..||.
  Fly   343 DERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFT 407

  Fly   409 FKQGLERH 416
            ....|:.|
  Fly   408 RNSNLKTH 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 20/83 (24%)
COG5048 <281..506 CDD:227381 47/142 (33%)
C2H2 Zn finger 288..308 CDD:275368 5/20 (25%)
C2H2 Zn finger 316..336 CDD:275368 7/21 (33%)
zf-H2C2_2 328..353 CDD:290200 10/26 (38%)
C2H2 Zn finger 344..364 CDD:275368 7/21 (33%)
C2H2 Zn finger 372..388 CDD:275370 6/16 (38%)
C2H2 Zn finger 400..420 CDD:275368 7/18 (39%)
C2H2 Zn finger 428..448 CDD:275368
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 19/75 (25%)
C2H2 Zn finger 282..302 CDD:275368 5/20 (25%)
C2H2 Zn finger 310..331 CDD:275368 7/21 (33%)
C2H2 Zn finger 339..360 CDD:275368 7/21 (33%)
C2H2 Zn finger 371..388 CDD:275370 7/17 (41%)
zf-met 398..421 CDD:289631 7/19 (37%)
C2H2 Zn finger 399..417 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.