DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG6813

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster

Alignment Length:451 Identity:93/452 (21%)
Similarity:145/452 (32%) Gaps:190/452 (42%)


  Fly    18 CRFCLTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFKQM 82
            ||.|........:|...     ..:|..||.:||.:|:.....:.|.:|..|....:...:|:|.
  Fly     6 CRICSRSDAPIDLFGPG-----NGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQR 65

  Fly    83 CKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTMAKSSSQVI 147
            |                            ::|.|:.|       |..|...|..:|     ..:|
  Fly    66 C----------------------------IIAEKQNL-------ERIECDSKDCST-----DPII 90

  Fly   148 IEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMASELEKEFPDIPQ 212
            .||                              :|:||             :.|||::.      
  Fly    91 YED------------------------------IDDNQ-------------IESELDES------ 106

  Fly   213 KASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKN 277
                                         :..|:||                |||:       .:
  Fly   107 -----------------------------ILCPEVK----------------DLPM-------PS 119

  Fly   278 AEKVA--------------TDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQC--LLCEKSFFSK 326
            ||||:              |..:.||||.|....:...:.|.|.||..::|.|  |.||:||.::
  Fly   120 AEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATR 184

  Fly   327 YDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAER 391
            .:|..|..:||||:|                            ::||||.:.|.|....::|..|
  Fly   185 KELTSHTRIHTGEQP----------------------------YVCVYCPRRFSSSGARQEHHRR 221

  Fly   392 HQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKR 452
            |:.:|.::|..|.|||.....|.:|:.:|.......|..|::.|...|.|..||.::..||
  Fly   222 HRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKR 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 16/74 (22%)
COG5048 <281..506 CDD:227381 52/189 (28%)
C2H2 Zn finger 288..308 CDD:275368 7/20 (35%)
C2H2 Zn finger 316..336 CDD:275368 8/22 (36%)
zf-H2C2_2 328..353 CDD:290200 7/25 (28%)
C2H2 Zn finger 344..364 CDD:275368 0/20 (0%)
C2H2 Zn finger 372..388 CDD:275370 6/16 (38%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 20/110 (18%)
C2H2 Zn finger 144..164 CDD:275368 7/20 (35%)
C2H2 Zn finger 172..194 CDD:275368 8/22 (36%)
zf-H2C2_2 186..211 CDD:290200 12/53 (23%)
UFD2 <256..>294 CDD:227443 9/28 (32%)
C2H2 Zn finger 258..280 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.