DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG14667

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster

Alignment Length:401 Identity:89/402 (22%)
Similarity:150/402 (37%) Gaps:106/402 (26%)


  Fly    17 VCRFC----LTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCY 77
            |||.|    :..|:..:|| .:.|.|....|.|    ||.:|:....|:|..:|..|....:...
  Fly     6 VCRICANKIMGHQRDRNIF-IHMRGKYLGQLKL----ITGVELTRNQGLPEIVCERCFSELDLAT 65

  Fly    78 RFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTMAKS 142
            :|::.|                            :.:.|.||.:..||::.|....:|       
  Fly    66 KFRERC----------------------------IFSQKYLLDIIKKTSDQSTVHVEL------- 95

  Fly   143 SSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMASELEKEF 207
            ||:.:  |.|::::..:                  |...|::|.:.....:...:|:.   |.|.
  Fly    96 SSEPL--DEQLIDADQL------------------ETHYDDDQYVCYQGTKEEHQDLE---EIEL 137

  Fly   208 PDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKR-----------DDSG----NVAI 257
            .|.|..|           .|........|..:..|...:::|           |:.|    :..:
  Fly   138 DDDPSAA-----------VIAAAEAAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFL 191

  Fly   258 VTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLN-HTRSRSFQCLLCEK 321
            .||.|:......|.:           ..||||:|.::|..:.||:.||.. |..:|.|||.:|.:
  Fly   192 YTEHLNGHQNRRDMN-----------QFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHE 245

  Fly   322 SFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHT-DVPKFICVYCEKPFLSRQEM 385
            :|.|.....:|:..|..|||:.|..|...|:..:.|..|..||: .:.||.|..|...|::|:.:
  Fly   246 AFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGL 310

  Fly   386 EKHAERHQKKR 396
            ..|.:....||
  Fly   311 VAHTKTAPHKR 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 20/79 (25%)
COG5048 <281..506 CDD:227381 39/119 (33%)
C2H2 Zn finger 288..308 CDD:275368 8/21 (38%)
C2H2 Zn finger 316..336 CDD:275368 5/20 (25%)
zf-H2C2_2 328..353 CDD:290200 8/25 (32%)
C2H2 Zn finger 344..364 CDD:275368 6/20 (30%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 428..448 CDD:275368
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 23/107 (21%)
C2H2 Zn finger 179..199 CDD:275368 5/20 (25%)
C2H2 Zn finger 211..232 CDD:275368 8/21 (38%)
C2H2 Zn finger 240..260 CDD:275368 5/20 (25%)
zf-C2H2_8 243..313 CDD:292531 21/70 (30%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 297..316 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.